SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124485333|ref|YP_001029949.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124485333|ref|YP_001029949.1|
Domain Number - Region: 86-161
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 0.0254
Family SerA intervening domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124485333|ref|YP_001029949.1|
Sequence length 182
Comment hypothetical protein Mlab_0508 [Methanocorpusculum labreanum Z]
Sequence
MTENSCPMCGSTFGSLLAKGILMIILGILMMVFTLASLFASEILLAVLLIFVGITLLTAG
TTFFGEVKRTWWVVLLGILVILFGILALIFPAIMLVYAMYVLAAAALIGGVTDLALALMG
TSAQVNRGLLAVSGILGIILGILFLINPIISAFTIVEIAGIFFFAFGIVAIIEAFMAKSA
TA
Download sequence
Identical sequences A2SQS6
WP_011832883.1.86236 410358.Mlab_0508 gi|124485333|ref|YP_001029949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]