SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124485813|ref|YP_001030429.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124485813|ref|YP_001030429.1|
Domain Number 1 Region: 9-199
Classification Level Classification E-value
Superfamily SIS domain 5.64e-36
Family mono-SIS domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124485813|ref|YP_001030429.1|
Sequence length 200
Comment hexulose-6-phosphate isomerase [Methanocorpusculum labreanum Z]
Sequence
MNYGVSVQNMMSLMASRIDAIAQKIPTDQVDAFLDAILAADRIYVMGAGRSGLVAKSFAM
RLMHTGFTAYVVGETITPAIGDTDLIIAFSGSGNTKTIGDIAETAKGLGAKVALVSSNPK
SRIGNIADFIIEIETQRDPVTCDAHEYEIRQMLGEHRSFAPLGTIFETSSLMFGDAVIST
LMDMKKIEEADLKRRHTNIE
Download sequence
Identical sequences A2SS56
410358.Mlab_0993 WP_011833365.1.86236 gi|124485813|ref|YP_001030429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]