SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124486184|ref|YP_001030800.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486184|ref|YP_001030800.1|
Domain Number 1 Region: 103-249
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.18e-28
Family MJ1460-like 0.039
Further Details:      
 
Domain Number 2 Region: 24-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.94e-16
Family MarR-like transcriptional regulators 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124486184|ref|YP_001030800.1|
Sequence length 252
Comment ArsR family transcriptional regulator [Methanocorpusculum labreanum Z]
Sequence
MPEPDSKEPLNIYSKKGTVITVRSPIRNRILYLLAEEGPVSFTRIMEYTGLSKSTVSGYV
NTLEMKGLISVRTDPRDARKKTYQITASHIGNITPSVQTGTSDFRELIRQAYAKYDKIDY
KEIIPHIIKVALSEAGINIDPVIMRGGEILGQAVAVYLVADTLDKTLANITEFWKHYGFG
EVRIRSTDPLQIEVYHCYECMIMPSDSGKSCAISCGMLKAIFSAYYNEKVNVEETQCMTE
GHDCCCMKIIRP
Download sequence
Identical sequences A2ST77
gi|124486184|ref|YP_001030800.1| 410358.Mlab_1366 WP_011833736.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]