SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124486358|ref|YP_001030974.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486358|ref|YP_001030974.1|
Domain Number 1 Region: 101-281
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.26e-58
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000685
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.46e-37
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00022
Further Details:      
 
Domain Number 3 Region: 318-449
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 1.07e-31
Family SerA intervening domain-like 0.0025
Further Details:      
 
Domain Number 4 Region: 451-525
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000112
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124486358|ref|YP_001030974.1|
Sequence length 527
Comment D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
Sequence
MSFKVLVSDPLAAEGIAILKDFCEVDEKADLSEDELVKIIGEYDALIVRSGTQVTARIIE
AADKMKYIGRAGVGVDNIDCEAATKKGIIVSNAPEGNTLAATEHTIAMMMAMARNIPQAS
ASLKKGEWKRSKFMGNEMNGKVLGVVGFGRIGREVAKRAQALQMTVIAYDPFIPAEVGAA
MGVEMMSVAELFTKADVITVHTPLIPSTTHLVNKESIATMKTGVRMINCARGGIIDEKDL
YDAIVSGKVAGAALDVFETEPPTESPLLKLDSVIVTPHLGASTVEAQKNVAISVAHQCID
VLKGGSAKSAVNAPLVTPEVKSKIDPYALLAEKMGSLAAQIADGAITEVEFAYLGEIADL
KQNLKYVTRLGIKGMLEQVLHEPANIVNAEIIAQGRGITIFEKTSSEAGDYKSLVTLTFK
TEKGSESISGIVTRAGPRILSIGKYATDLVPSGYVILADHVNRPGVVGPVGMILGKHNVN
ISSMQVGGRNVGSESLMILAVDDIVSPEVMQEVASSDGITAAKFVRL
Download sequence
Identical sequences A2STQ1
410358.Mlab_1543 gi|124486358|ref|YP_001030974.1| WP_011833910.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]