SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124486553|ref|YP_001031169.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486553|ref|YP_001031169.1|
Domain Number 1 Region: 1-220
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 2.88e-37
Family NIF3 (NGG1p interacting factor 3)-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124486553|ref|YP_001031169.1|
Sequence length 243
Comment hypothetical protein Mlab_1741 [Methanocorpusculum labreanum Z]
Sequence
MIVADLIAQIETSVPPIYSMVGDEPQFFGSSQTLQTDISKVTVMMDYYSGQIIPEDTEFL
VLHHPPKTGIPPLPTYVLHSGWDAFPGGAGDALADVFELTERALLDASTRLGRVGKLPNG
AVSLDEFAKQAAKKLGRPYLQIVSEIPDISIETVAVVSGFGLNPSMIKLAKQKGADVFLS
GDLTHPGAILAKSLTIPLIDATHYATELPGLYRLRDLIASFGVESAVFDTSVPWRMKTYY
ENY
Download sequence
Identical sequences A2SU96
gi|124486553|ref|YP_001031169.1| 410358.Mlab_1741 WP_011834105.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]