SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387878827|ref|YP_006309130.1| from Streptococcus parasanguinis FW213

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387878827|ref|YP_006309130.1|
Domain Number 1 Region: 124-271
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.03e-47
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00013
Further Details:      
 
Domain Number 2 Region: 5-122
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 6.12e-30
Family DHN aldolase/epimerase 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387878827|ref|YP_006309130.1|
Sequence length 272
Comment Folate synthesis protein [Streptococcus parasanguinis FW213]
Sequence
MNRVDQLRIKDLEVYAYHGVFPAEKELGQRFVLDLWVDYEMTRAARTGDLEASIHYGILA
EQLTEWMQAEKIDLIETVAFQLVQKIFESYSFVEKVRLELKKPWAPVSLPLETCSVTIER
EKKRAFIGLGTNMGDKQLQLETALEKIRDRGIRLLQTSTRIETEPWGGVEQDTFLNQVAE
VETWMTPEDLLETLLAIEQEMGRVREVKWGPRVIDLDLLYMEDTICYSPSLILPHPYVAE
RAFVLESLNEIAPHFVDPVQRKPIRQLWDAVK
Download sequence
Identical sequences I1ZJU5
gi|387878827|ref|YP_006309130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]