SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151381|ref|YP_008940326.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151381|ref|YP_008940326.1|
Domain Number 1 Region: 156-270
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 2.55e-25
Family TonB 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568151381|ref|YP_008940326.1|
Sequence length 270
Comment cell envelope biogenesis protein TonB [Pseudomonas aeruginosa LES431]
Sequence
MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRVLSRRETILLVLFALT
LHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPPEPLPPVVEEPPPPVID
ENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPAAPPAPPAPAAAPAPLTP
PSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSEIQVQKSSGREALDQAAVK
AVKRWSFVPAKRGDKAEDGWVSVPIDFKLN
Download sequence
Identical sequences gi|568151381|ref|YP_008940326.1| 557722.PLES_01981 WP_012613461.1.11026 WP_012613461.1.11943 WP_012613461.1.13232 WP_012613461.1.14714 WP_012613461.1.1475 WP_012613461.1.21517 WP_012613461.1.22863 WP_012613461.1.23195 WP_012613461.1.23715 WP_012613461.1.24351 WP_012613461.1.251 WP_012613461.1.25142 WP_012613461.1.27837 WP_012613461.1.31279 WP_012613461.1.33210 WP_012613461.1.34832 WP_012613461.1.35857 WP_012613461.1.3833 WP_012613461.1.39088 WP_012613461.1.43662 WP_012613461.1.45090 WP_012613461.1.45485 WP_012613461.1.45934 WP_012613461.1.46152 WP_012613461.1.52690 WP_012613461.1.56797 WP_012613461.1.60415 WP_012613461.1.60603 WP_012613461.1.62516 WP_012613461.1.62534 WP_012613461.1.62701 WP_012613461.1.65099 WP_012613461.1.66526 WP_012613461.1.67388 WP_012613461.1.67686 WP_012613461.1.68862 WP_012613461.1.72331 WP_012613461.1.73149 WP_012613461.1.7547 WP_012613461.1.78430 WP_012613461.1.86545 WP_012613461.1.87435 WP_012613461.1.91431 WP_012613461.1.92769 WP_012613461.1.95460 WP_012613461.1.9722 WP_012613461.1.99757 gi|218888942|ref|YP_002437806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]