SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151588|ref|YP_008940535.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151588|ref|YP_008940535.1|
Domain Number 1 Region: 107-114,185-292
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 8.5e-20
Family TolA 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568151588|ref|YP_008940535.1|
Sequence length 297
Comment cell envelope biogenesis protein TonB [Pseudomonas aeruginosa LES431]
Sequence
MNAAVLKSPSAAAGVRPADRLGFTLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATF
KSDKAPEKADYLAQMNQQGSGTLEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAP
KAAVTTTRQRQQKAPSKTQAQKAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRP
RIHRLSAASTMRDKGAWYKEDWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIY
EVQVLESSGEPILDQAAQRIVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK
Download sequence
Identical sequences A0A071KSY4 A0A0H3QY38 A0A157U689 A0A1C7BUZ0 A0A1G5LVG0 V6A7Q0
gi|568151588|ref|YP_008940535.1| WP_003084580.1.11180 WP_003084580.1.21209 WP_003084580.1.39122 WP_003084580.1.48840 WP_003084580.1.57477 WP_003084580.1.88152 gi|386068684|ref|YP_005983988.1| gi|392981819|ref|YP_006480406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]