SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151630|ref|YP_008940577.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151630|ref|YP_008940577.1|
Domain Number 1 Region: 25-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.28e-26
Family Clp protease, ClpP subunit 0.053
Further Details:      
 
Domain Number 2 Region: 370-436
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000929
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568151630|ref|YP_008940577.1|
Sequence length 443
Comment peptidase [Pseudomonas aeruginosa LES431]
Sequence
MRMPCRLALALLLCFAGPACLAASGPVRVLSVDGAIGPASADYLVRGIERAAEDGAQLVV
LELDTPGGLDASMRRIVKAILASQVPVAGFVAPSGARAASAGTYILYACHIAAMAPGTNL
GAATPVRLGTPDKPAEKPPARDADPMARKQVNDAAAYIRGLAQLRGRNAEWAERAVREAV
SLAAHEAAAQKVIDLQARDLPDLLRQLDSRSLRVGERALTLATAGATVERQAPDWRARLL
AVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLLLGLYALQMLPVNYAGLALI
ALGLAFMVGEAFVASFGVLGIGGIVSFVVGALILIDTEVPGYGIPPGLVVALALLSAALI
VGLLGMALRTRRQAVVSGTAGLVGSLATVAAVDSEQPCAGWVLLQGERWRVLAARPLAVG
QPVWVLARKGLLLEVALADEGGG
Download sequence
Identical sequences Q9I667
gi|568151630|ref|YP_008940577.1| gi|15595648|ref|NP_249142.1| 208964.PA0451 557722.PLES_04471 gi|218889191|ref|YP_002438055.1| NP_249142.1.87394 WP_003113277.1.11026 WP_003113277.1.11943 WP_003113277.1.1238 WP_003113277.1.13232 WP_003113277.1.14714 WP_003113277.1.1475 WP_003113277.1.18204 WP_003113277.1.18653 WP_003113277.1.21517 WP_003113277.1.22863 WP_003113277.1.23195 WP_003113277.1.23715 WP_003113277.1.24351 WP_003113277.1.251 WP_003113277.1.25142 WP_003113277.1.26489 WP_003113277.1.27837 WP_003113277.1.31279 WP_003113277.1.32544 WP_003113277.1.33210 WP_003113277.1.34832 WP_003113277.1.34876 WP_003113277.1.35480 WP_003113277.1.35857 WP_003113277.1.3833 WP_003113277.1.39088 WP_003113277.1.41773 WP_003113277.1.41871 WP_003113277.1.43662 WP_003113277.1.45090 WP_003113277.1.45485 WP_003113277.1.45934 WP_003113277.1.46152 WP_003113277.1.47774 WP_003113277.1.48413 WP_003113277.1.50653 WP_003113277.1.52690 WP_003113277.1.55347 WP_003113277.1.56797 WP_003113277.1.59076 WP_003113277.1.60415 WP_003113277.1.60603 WP_003113277.1.62357 WP_003113277.1.62516 WP_003113277.1.62534 WP_003113277.1.62701 WP_003113277.1.65066 WP_003113277.1.65099 WP_003113277.1.66526 WP_003113277.1.67388 WP_003113277.1.67686 WP_003113277.1.68857 WP_003113277.1.68862 WP_003113277.1.72331 WP_003113277.1.73149 WP_003113277.1.73455 WP_003113277.1.7547 WP_003113277.1.78430 WP_003113277.1.8110 WP_003113277.1.81771 WP_003113277.1.84374 WP_003113277.1.84715 WP_003113277.1.86545 WP_003113277.1.87435 WP_003113277.1.91431 WP_003113277.1.92175 WP_003113277.1.92624 WP_003113277.1.92769 WP_003113277.1.95460 WP_003113277.1.98600 WP_003113277.1.99461 WP_003113277.1.99757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]