SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151648|ref|YP_008940595.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151648|ref|YP_008940595.1|
Domain Number 1 Region: 77-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.16e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000288
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568151648|ref|YP_008940595.1|
Sequence length 206
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MSATHTLFYAAASPFVRKVLVLLHETGQRERVALEEVTPTPVAPIRQLNASNPAGKIPAL
RLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIASLADAVLDAAVLSRYETF
VRPEEKRWDTWLEAQREKIGRSLAWLEGDCIAELQARFDIAAIGVACALGYLDLRQPEWD
WRGRYPRLAAWFAEVSQRPSMQATRA
Download sequence
Identical sequences A0A0D6FN13 A0A1F0IWM9 Q9I651
NP_249158.1.87394 WP_003113265.1.100179 WP_003113265.1.100394 WP_003113265.1.100654 WP_003113265.1.100723 WP_003113265.1.100777 WP_003113265.1.100786 WP_003113265.1.100808 WP_003113265.1.100809 WP_003113265.1.100872 WP_003113265.1.100983 WP_003113265.1.101021 WP_003113265.1.101572 WP_003113265.1.101642 WP_003113265.1.10185 WP_003113265.1.101863 WP_003113265.1.10407 WP_003113265.1.10457 WP_003113265.1.10468 WP_003113265.1.10477 WP_003113265.1.10636 WP_003113265.1.10684 WP_003113265.1.10856 WP_003113265.1.10901 WP_003113265.1.10949 WP_003113265.1.11026 WP_003113265.1.11381 WP_003113265.1.11388 WP_003113265.1.11454 WP_003113265.1.11568 WP_003113265.1.11943 WP_003113265.1.12018 WP_003113265.1.12208 WP_003113265.1.12240 WP_003113265.1.12497 WP_003113265.1.12561 WP_003113265.1.12657 WP_003113265.1.12670 WP_003113265.1.12922 WP_003113265.1.13232 WP_003113265.1.13242 WP_003113265.1.13785 WP_003113265.1.13828 WP_003113265.1.13865 WP_003113265.1.14049 WP_003113265.1.14078 WP_003113265.1.14204 WP_003113265.1.14460 WP_003113265.1.14463 WP_003113265.1.14476 WP_003113265.1.14714 WP_003113265.1.1475 WP_003113265.1.15297 WP_003113265.1.15480 WP_003113265.1.15482 WP_003113265.1.15889 WP_003113265.1.16074 WP_003113265.1.16267 WP_003113265.1.16419 WP_003113265.1.16660 WP_003113265.1.16782 WP_003113265.1.16895 WP_003113265.1.17022 WP_003113265.1.17354 WP_003113265.1.17397 WP_003113265.1.18052 WP_003113265.1.18199 WP_003113265.1.18204 WP_003113265.1.18234 WP_003113265.1.1824 WP_003113265.1.18493 WP_003113265.1.18653 WP_003113265.1.18728 WP_003113265.1.18769 WP_003113265.1.18892 WP_003113265.1.18911 WP_003113265.1.18930 WP_003113265.1.19376 WP_003113265.1.1938 WP_003113265.1.20070 WP_003113265.1.20216 WP_003113265.1.20342 WP_003113265.1.21100 WP_003113265.1.21166 WP_003113265.1.2144 WP_003113265.1.21460 WP_003113265.1.21517 WP_003113265.1.21767 WP_003113265.1.21863 WP_003113265.1.22078 WP_003113265.1.2228 WP_003113265.1.22324 WP_003113265.1.22671 WP_003113265.1.22704 WP_003113265.1.22863 WP_003113265.1.23195 WP_003113265.1.2323 WP_003113265.1.23394 WP_003113265.1.236 WP_003113265.1.23611 WP_003113265.1.23715 WP_003113265.1.23769 WP_003113265.1.23794 WP_003113265.1.23983 WP_003113265.1.24351 WP_003113265.1.24447 WP_003113265.1.24662 WP_003113265.1.24862 WP_003113265.1.24879 WP_003113265.1.251 WP_003113265.1.25142 WP_003113265.1.25328 WP_003113265.1.25344 WP_003113265.1.25600 WP_003113265.1.25903 WP_003113265.1.26334 WP_003113265.1.26463 WP_003113265.1.26489 WP_003113265.1.2652 WP_003113265.1.26604 WP_003113265.1.2698 WP_003113265.1.27107 WP_003113265.1.27837 WP_003113265.1.27966 WP_003113265.1.283 WP_003113265.1.28316 WP_003113265.1.28329 WP_003113265.1.28372 WP_003113265.1.28382 WP_003113265.1.28383 WP_003113265.1.28404 WP_003113265.1.28623 WP_003113265.1.28800 WP_003113265.1.28823 WP_003113265.1.29062 WP_003113265.1.29158 WP_003113265.1.29401 WP_003113265.1.29438 WP_003113265.1.29472 WP_003113265.1.29668 WP_003113265.1.30120 WP_003113265.1.30474 WP_003113265.1.3072 WP_003113265.1.30740 WP_003113265.1.30797 WP_003113265.1.30815 WP_003113265.1.31279 WP_003113265.1.31741 WP_003113265.1.31848 WP_003113265.1.31852 WP_003113265.1.32447 WP_003113265.1.32523 WP_003113265.1.32544 WP_003113265.1.32869 WP_003113265.1.32879 WP_003113265.1.33186 WP_003113265.1.33204 WP_003113265.1.33210 WP_003113265.1.33653 WP_003113265.1.3376 WP_003113265.1.33774 WP_003113265.1.33801 WP_003113265.1.33824 WP_003113265.1.34039 WP_003113265.1.34151 WP_003113265.1.34306 WP_003113265.1.34324 WP_003113265.1.3452 WP_003113265.1.34568 WP_003113265.1.34689 WP_003113265.1.34832 WP_003113265.1.34876 WP_003113265.1.34922 WP_003113265.1.34942 WP_003113265.1.35036 WP_003113265.1.35231 WP_003113265.1.35353 WP_003113265.1.3540 WP_003113265.1.35480 WP_003113265.1.35512 WP_003113265.1.3568 WP_003113265.1.35857 WP_003113265.1.36378 WP_003113265.1.36487 WP_003113265.1.3653 WP_003113265.1.3662 WP_003113265.1.36879 WP_003113265.1.37125 WP_003113265.1.37319 WP_003113265.1.38186 WP_003113265.1.3833 WP_003113265.1.38406 WP_003113265.1.38502 WP_003113265.1.38505 WP_003113265.1.38657 WP_003113265.1.38727 WP_003113265.1.38834 WP_003113265.1.39088 WP_003113265.1.39122 WP_003113265.1.39326 WP_003113265.1.39811 WP_003113265.1.40059 WP_003113265.1.40207 WP_003113265.1.40213 WP_003113265.1.40513 WP_003113265.1.40595 WP_003113265.1.40703 WP_003113265.1.40874 WP_003113265.1.40994 WP_003113265.1.41492 WP_003113265.1.41624 WP_003113265.1.41692 WP_003113265.1.41773 WP_003113265.1.41871 WP_003113265.1.41939 WP_003113265.1.42463 WP_003113265.1.42643 WP_003113265.1.42696 WP_003113265.1.42856 WP_003113265.1.42952 WP_003113265.1.42973 WP_003113265.1.43049 WP_003113265.1.43106 WP_003113265.1.43107 WP_003113265.1.4348 WP_003113265.1.43662 WP_003113265.1.43802 WP_003113265.1.4381 WP_003113265.1.43811 WP_003113265.1.44094 WP_003113265.1.44563 WP_003113265.1.45063 WP_003113265.1.45090 WP_003113265.1.45202 WP_003113265.1.45228 WP_003113265.1.45312 WP_003113265.1.45328 WP_003113265.1.45478 WP_003113265.1.45485 WP_003113265.1.45711 WP_003113265.1.45723 WP_003113265.1.45934 WP_003113265.1.45961 WP_003113265.1.46032 WP_003113265.1.46152 WP_003113265.1.46436 WP_003113265.1.46502 WP_003113265.1.46826 WP_003113265.1.46846 WP_003113265.1.47150 WP_003113265.1.47251 WP_003113265.1.47296 WP_003113265.1.47480 WP_003113265.1.47598 WP_003113265.1.47774 WP_003113265.1.48094 WP_003113265.1.48172 WP_003113265.1.48321 WP_003113265.1.4836 WP_003113265.1.48413 WP_003113265.1.48474 WP_003113265.1.48545 WP_003113265.1.48870 WP_003113265.1.49277 WP_003113265.1.49286 WP_003113265.1.49416 WP_003113265.1.49557 WP_003113265.1.50567 WP_003113265.1.50653 WP_003113265.1.50668 WP_003113265.1.50734 WP_003113265.1.5132 WP_003113265.1.51538 WP_003113265.1.51847 WP_003113265.1.51976 WP_003113265.1.52146 WP_003113265.1.52152 WP_003113265.1.52690 WP_003113265.1.52810 WP_003113265.1.53351 WP_003113265.1.53371 WP_003113265.1.53726 WP_003113265.1.53826 WP_003113265.1.53948 WP_003113265.1.54078 WP_003113265.1.54090 WP_003113265.1.54248 WP_003113265.1.5427 WP_003113265.1.54571 WP_003113265.1.55347 WP_003113265.1.55478 WP_003113265.1.55729 WP_003113265.1.56013 WP_003113265.1.56171 WP_003113265.1.56188 WP_003113265.1.56228 WP_003113265.1.56474 WP_003113265.1.56745 WP_003113265.1.56797 WP_003113265.1.56808 WP_003113265.1.57131 WP_003113265.1.57140 WP_003113265.1.5731 WP_003113265.1.57460 WP_003113265.1.57839 WP_003113265.1.58019 WP_003113265.1.58056 WP_003113265.1.58155 WP_003113265.1.58162 WP_003113265.1.58294 WP_003113265.1.58785 WP_003113265.1.59076 WP_003113265.1.59176 WP_003113265.1.59246 WP_003113265.1.59250 WP_003113265.1.5937 WP_003113265.1.594 WP_003113265.1.59469 WP_003113265.1.59688 WP_003113265.1.59759 WP_003113265.1.60051 WP_003113265.1.60082 WP_003113265.1.60415 WP_003113265.1.60603 WP_003113265.1.61191 WP_003113265.1.61299 WP_003113265.1.61366 WP_003113265.1.61696 WP_003113265.1.62010 WP_003113265.1.62180 WP_003113265.1.62186 WP_003113265.1.62357 WP_003113265.1.62396 WP_003113265.1.62516 WP_003113265.1.62534 WP_003113265.1.62688 WP_003113265.1.62701 WP_003113265.1.62917 WP_003113265.1.63041 WP_003113265.1.63057 WP_003113265.1.63193 WP_003113265.1.63338 WP_003113265.1.63369 WP_003113265.1.63634 WP_003113265.1.63995 WP_003113265.1.64329 WP_003113265.1.64433 WP_003113265.1.64591 WP_003113265.1.64748 WP_003113265.1.64854 WP_003113265.1.64983 WP_003113265.1.65066 WP_003113265.1.65092 WP_003113265.1.65099 WP_003113265.1.65197 WP_003113265.1.65335 WP_003113265.1.65588 WP_003113265.1.65740 WP_003113265.1.6589 WP_003113265.1.66062 WP_003113265.1.66345 WP_003113265.1.66526 WP_003113265.1.67010 WP_003113265.1.67188 WP_003113265.1.67269 WP_003113265.1.6734 WP_003113265.1.67388 WP_003113265.1.67686 WP_003113265.1.67755 WP_003113265.1.67903 WP_003113265.1.67948 WP_003113265.1.6808 WP_003113265.1.68158 WP_003113265.1.68561 WP_003113265.1.68781 WP_003113265.1.68857 WP_003113265.1.68862 WP_003113265.1.6931 WP_003113265.1.6937 WP_003113265.1.69788 WP_003113265.1.69791 WP_003113265.1.70092 WP_003113265.1.70194 WP_003113265.1.70216 WP_003113265.1.70229 WP_003113265.1.70460 WP_003113265.1.70670 WP_003113265.1.70831 WP_003113265.1.71806 WP_003113265.1.71934 WP_003113265.1.72149 WP_003113265.1.72181 WP_003113265.1.72331 WP_003113265.1.72378 WP_003113265.1.72447 WP_003113265.1.72669 WP_003113265.1.73149 WP_003113265.1.7329 WP_003113265.1.733 WP_003113265.1.73455 WP_003113265.1.73523 WP_003113265.1.73541 WP_003113265.1.73728 WP_003113265.1.73889 WP_003113265.1.74 WP_003113265.1.74072 WP_003113265.1.74074 WP_003113265.1.7408 WP_003113265.1.74264 WP_003113265.1.74772 WP_003113265.1.74878 WP_003113265.1.74948 WP_003113265.1.75204 WP_003113265.1.7547 WP_003113265.1.75599 WP_003113265.1.75860 WP_003113265.1.7666 WP_003113265.1.76791 WP_003113265.1.76922 WP_003113265.1.77587 WP_003113265.1.77686 WP_003113265.1.77819 WP_003113265.1.78380 WP_003113265.1.78409 WP_003113265.1.78430 WP_003113265.1.78669 WP_003113265.1.78810 WP_003113265.1.78926 WP_003113265.1.79193 WP_003113265.1.79357 WP_003113265.1.7945 WP_003113265.1.79463 WP_003113265.1.79507 WP_003113265.1.80306 WP_003113265.1.80644 WP_003113265.1.80929 WP_003113265.1.80938 WP_003113265.1.8110 WP_003113265.1.81482 WP_003113265.1.81742 WP_003113265.1.81748 WP_003113265.1.81771 WP_003113265.1.81986 WP_003113265.1.82178 WP_003113265.1.82260 WP_003113265.1.8227 WP_003113265.1.82442 WP_003113265.1.82487 WP_003113265.1.82580 WP_003113265.1.82643 WP_003113265.1.82710 WP_003113265.1.82864 WP_003113265.1.82887 WP_003113265.1.82936 WP_003113265.1.83463 WP_003113265.1.8353 WP_003113265.1.83946 WP_003113265.1.84162 WP_003113265.1.8437 WP_003113265.1.84374 WP_003113265.1.84404 WP_003113265.1.84715 WP_003113265.1.85220 WP_003113265.1.85290 WP_003113265.1.85298 WP_003113265.1.85357 WP_003113265.1.85446 WP_003113265.1.86055 WP_003113265.1.861 WP_003113265.1.86125 WP_003113265.1.86545 WP_003113265.1.86774 WP_003113265.1.86780 WP_003113265.1.87163 WP_003113265.1.87183 WP_003113265.1.87435 WP_003113265.1.87648 WP_003113265.1.87763 WP_003113265.1.88308 WP_003113265.1.88330 WP_003113265.1.88360 WP_003113265.1.8852 WP_003113265.1.88550 WP_003113265.1.88659 WP_003113265.1.88969 WP_003113265.1.89083 WP_003113265.1.89276 WP_003113265.1.89409 WP_003113265.1.89638 WP_003113265.1.89992 WP_003113265.1.90032 WP_003113265.1.90056 WP_003113265.1.90110 WP_003113265.1.90141 WP_003113265.1.90150 WP_003113265.1.90225 WP_003113265.1.90268 WP_003113265.1.9056 WP_003113265.1.90655 WP_003113265.1.90999 WP_003113265.1.91161 WP_003113265.1.91336 WP_003113265.1.91431 WP_003113265.1.91803 WP_003113265.1.91838 WP_003113265.1.91846 WP_003113265.1.91862 WP_003113265.1.92175 WP_003113265.1.92314 WP_003113265.1.92357 WP_003113265.1.92454 WP_003113265.1.92589 WP_003113265.1.92624 WP_003113265.1.92642 WP_003113265.1.92769 WP_003113265.1.92847 WP_003113265.1.92930 WP_003113265.1.93001 WP_003113265.1.93090 WP_003113265.1.93498 WP_003113265.1.93547 WP_003113265.1.93562 WP_003113265.1.94136 WP_003113265.1.94211 WP_003113265.1.94818 WP_003113265.1.94874 WP_003113265.1.95056 WP_003113265.1.95217 WP_003113265.1.95359 WP_003113265.1.95460 WP_003113265.1.95488 WP_003113265.1.95638 WP_003113265.1.95787 WP_003113265.1.96134 WP_003113265.1.96384 WP_003113265.1.96452 WP_003113265.1.96702 WP_003113265.1.96714 WP_003113265.1.96967 WP_003113265.1.9706 WP_003113265.1.9722 WP_003113265.1.977 WP_003113265.1.97826 WP_003113265.1.98276 WP_003113265.1.98433 WP_003113265.1.98515 WP_003113265.1.98573 WP_003113265.1.98600 WP_003113265.1.98788 WP_003113265.1.98814 WP_003113265.1.98958 WP_003113265.1.98960 WP_003113265.1.99293 WP_003113265.1.99353 WP_003113265.1.99389 WP_003113265.1.99461 WP_003113265.1.99516 WP_003113265.1.99654 WP_003113265.1.99662 WP_003113265.1.99746 WP_003113265.1.99757 WP_003113265.1.9989 208964.PA0467 557722.PLES_04631 gi|218889207|ref|YP_002438071.1| gi|15595664|ref|NP_249158.1| gi|568151648|ref|YP_008940595.1| gi|514408064|ref|YP_008130932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]