SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151654|ref|YP_008940601.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151654|ref|YP_008940601.1|
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 78-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.99e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568151654|ref|YP_008940601.1|
Sequence length 249
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MAEPLLIIGSYLSPYVRKVLVLLELKGIAYRIDPIVPFFGDEAFERLSPLRQIPVLVDGD
FVLNDSSVICQYLEERYPQPSLYPVDIGQRAQARWLEEYADSRLGQVIIWQLFHQLVINR
GIWQREPDQAILQRTYDEDLPSICNYLEGRVPPSGWLCGELSIADVAVACLFRNAQLARY
QVDGERWPRLARLLADAFALPAFQHLARFEKATAQTPVAEQRQALREAGAPLSATSHARE
RPVRGPMSR
Download sequence
Identical sequences A0A0H3R5Q3 A0A1F0IY42
gi|392981884|ref|YP_006480471.1| gi|218889213|ref|YP_002438077.1| gi|514408070|ref|YP_008130938.1| gi|568307236|ref|YP_008979505.1| WP_003105233.1.100456 WP_003105233.1.100654 WP_003105233.1.100786 WP_003105233.1.100872 WP_003105233.1.101340 WP_003105233.1.101506 WP_003105233.1.101572 WP_003105233.1.101712 WP_003105233.1.101819 WP_003105233.1.10185 WP_003105233.1.101871 WP_003105233.1.10201 WP_003105233.1.10204 WP_003105233.1.10257 WP_003105233.1.1037 WP_003105233.1.10468 WP_003105233.1.10477 WP_003105233.1.10529 WP_003105233.1.10901 WP_003105233.1.11026 WP_003105233.1.1109 WP_003105233.1.11381 WP_003105233.1.11410 WP_003105233.1.11417 WP_003105233.1.11568 WP_003105233.1.11943 WP_003105233.1.12208 WP_003105233.1.12240 WP_003105233.1.12302 WP_003105233.1.1238 WP_003105233.1.12530 WP_003105233.1.12687 WP_003105233.1.12797 WP_003105233.1.13208 WP_003105233.1.13232 WP_003105233.1.13315 WP_003105233.1.13529 WP_003105233.1.13785 WP_003105233.1.13795 WP_003105233.1.1393 WP_003105233.1.14078 WP_003105233.1.14424 WP_003105233.1.14460 WP_003105233.1.14564 WP_003105233.1.14640 WP_003105233.1.14714 WP_003105233.1.1475 WP_003105233.1.14754 WP_003105233.1.14835 WP_003105233.1.14839 WP_003105233.1.15130 WP_003105233.1.152 WP_003105233.1.15373 WP_003105233.1.16239 WP_003105233.1.16267 WP_003105233.1.16279 WP_003105233.1.16694 WP_003105233.1.16782 WP_003105233.1.16808 WP_003105233.1.17022 WP_003105233.1.17370 WP_003105233.1.18204 WP_003105233.1.18234 WP_003105233.1.18493 WP_003105233.1.18728 WP_003105233.1.18769 WP_003105233.1.18852 WP_003105233.1.19552 WP_003105233.1.19591 WP_003105233.1.1971 WP_003105233.1.19741 WP_003105233.1.19824 WP_003105233.1.19931 WP_003105233.1.20070 WP_003105233.1.20125 WP_003105233.1.20342 WP_003105233.1.20929 WP_003105233.1.21302 WP_003105233.1.21358 WP_003105233.1.21469 WP_003105233.1.21517 WP_003105233.1.21718 WP_003105233.1.21744 WP_003105233.1.21782 WP_003105233.1.22078 WP_003105233.1.22324 WP_003105233.1.22394 WP_003105233.1.22729 WP_003105233.1.22863 WP_003105233.1.23195 WP_003105233.1.23331 WP_003105233.1.23715 WP_003105233.1.23739 WP_003105233.1.23782 WP_003105233.1.23983 WP_003105233.1.24077 WP_003105233.1.24351 WP_003105233.1.24447 WP_003105233.1.24851 WP_003105233.1.24869 WP_003105233.1.25033 WP_003105233.1.251 WP_003105233.1.2511 WP_003105233.1.25142 WP_003105233.1.25191 WP_003105233.1.25271 WP_003105233.1.25477 WP_003105233.1.2596 WP_003105233.1.26025 WP_003105233.1.26301 WP_003105233.1.26334 WP_003105233.1.26592 WP_003105233.1.26604 WP_003105233.1.26681 WP_003105233.1.26705 WP_003105233.1.26967 WP_003105233.1.27028 WP_003105233.1.27587 WP_003105233.1.27687 WP_003105233.1.27783 WP_003105233.1.27837 WP_003105233.1.27939 WP_003105233.1.28057 WP_003105233.1.28064 WP_003105233.1.28329 WP_003105233.1.28560 WP_003105233.1.28623 WP_003105233.1.28823 WP_003105233.1.29096 WP_003105233.1.29401 WP_003105233.1.2941 WP_003105233.1.29438 WP_003105233.1.29481 WP_003105233.1.29498 WP_003105233.1.29848 WP_003105233.1.30000 WP_003105233.1.30365 WP_003105233.1.30475 WP_003105233.1.30614 WP_003105233.1.30973 WP_003105233.1.31045 WP_003105233.1.31279 WP_003105233.1.31501 WP_003105233.1.31565 WP_003105233.1.31939 WP_003105233.1.32134 WP_003105233.1.32144 WP_003105233.1.32314 WP_003105233.1.32544 WP_003105233.1.32596 WP_003105233.1.32711 WP_003105233.1.32869 WP_003105233.1.32879 WP_003105233.1.33186 WP_003105233.1.33204 WP_003105233.1.33210 WP_003105233.1.33517 WP_003105233.1.33521 WP_003105233.1.33549 WP_003105233.1.33774 WP_003105233.1.34039 WP_003105233.1.34151 WP_003105233.1.34191 WP_003105233.1.34306 WP_003105233.1.34317 WP_003105233.1.34401 WP_003105233.1.34625 WP_003105233.1.34832 WP_003105233.1.34837 WP_003105233.1.34876 WP_003105233.1.35231 WP_003105233.1.35325 WP_003105233.1.35857 WP_003105233.1.36266 WP_003105233.1.36378 WP_003105233.1.36435 WP_003105233.1.36521 WP_003105233.1.3653 WP_003105233.1.36630 WP_003105233.1.36781 WP_003105233.1.37319 WP_003105233.1.37366 WP_003105233.1.37818 WP_003105233.1.38003 WP_003105233.1.38186 WP_003105233.1.3833 WP_003105233.1.38337 WP_003105233.1.38430 WP_003105233.1.38502 WP_003105233.1.38657 WP_003105233.1.38971 WP_003105233.1.39088 WP_003105233.1.39345 WP_003105233.1.3943 WP_003105233.1.39811 WP_003105233.1.3998 WP_003105233.1.40059 WP_003105233.1.40213 WP_003105233.1.40541 WP_003105233.1.40546 WP_003105233.1.40994 WP_003105233.1.41291 WP_003105233.1.41384 WP_003105233.1.41502 WP_003105233.1.41618 WP_003105233.1.41625 WP_003105233.1.41748 WP_003105233.1.42019 WP_003105233.1.42259 WP_003105233.1.42789 WP_003105233.1.42917 WP_003105233.1.42952 WP_003105233.1.42972 WP_003105233.1.43026 WP_003105233.1.4348 WP_003105233.1.43593 WP_003105233.1.43603 WP_003105233.1.43662 WP_003105233.1.43673 WP_003105233.1.43783 WP_003105233.1.4398 WP_003105233.1.44094 WP_003105233.1.44213 WP_003105233.1.44373 WP_003105233.1.44434 WP_003105233.1.45063 WP_003105233.1.45090 WP_003105233.1.45199 WP_003105233.1.45202 WP_003105233.1.45328 WP_003105233.1.45478 WP_003105233.1.45485 WP_003105233.1.45711 WP_003105233.1.45920 WP_003105233.1.45934 WP_003105233.1.46032 WP_003105233.1.46093 WP_003105233.1.46152 WP_003105233.1.46200 WP_003105233.1.46623 WP_003105233.1.46787 WP_003105233.1.46866 WP_003105233.1.47158 WP_003105233.1.47296 WP_003105233.1.47469 WP_003105233.1.47480 WP_003105233.1.47527 WP_003105233.1.47774 WP_003105233.1.48024 WP_003105233.1.48094 WP_003105233.1.48141 WP_003105233.1.48172 WP_003105233.1.48334 WP_003105233.1.4836 WP_003105233.1.48545 WP_003105233.1.48747 WP_003105233.1.49360 WP_003105233.1.49416 WP_003105233.1.49566 WP_003105233.1.50180 WP_003105233.1.50682 WP_003105233.1.50734 WP_003105233.1.50967 WP_003105233.1.50989 WP_003105233.1.51457 WP_003105233.1.51538 WP_003105233.1.51585 WP_003105233.1.51847 WP_003105233.1.51889 WP_003105233.1.51943 WP_003105233.1.51976 WP_003105233.1.5226 WP_003105233.1.5235 WP_003105233.1.52355 WP_003105233.1.52449 WP_003105233.1.5260 WP_003105233.1.52690 WP_003105233.1.52728 WP_003105233.1.5294 WP_003105233.1.53070 WP_003105233.1.53267 WP_003105233.1.53287 WP_003105233.1.53371 WP_003105233.1.53427 WP_003105233.1.53486 WP_003105233.1.53530 WP_003105233.1.53678 WP_003105233.1.53726 WP_003105233.1.53948 WP_003105233.1.54090 WP_003105233.1.54133 WP_003105233.1.54140 WP_003105233.1.5420 WP_003105233.1.5427 WP_003105233.1.54462 WP_003105233.1.55318 WP_003105233.1.55543 WP_003105233.1.56013 WP_003105233.1.56196 WP_003105233.1.56348 WP_003105233.1.56475 WP_003105233.1.56632 WP_003105233.1.56745 WP_003105233.1.56768 WP_003105233.1.56797 WP_003105233.1.57480 WP_003105233.1.57532 WP_003105233.1.57566 WP_003105233.1.57728 WP_003105233.1.58228 WP_003105233.1.59076 WP_003105233.1.59176 WP_003105233.1.59246 WP_003105233.1.59249 WP_003105233.1.59250 WP_003105233.1.59724 WP_003105233.1.59870 WP_003105233.1.60051 WP_003105233.1.60085 WP_003105233.1.60347 WP_003105233.1.60415 WP_003105233.1.60467 WP_003105233.1.60603 WP_003105233.1.60910 WP_003105233.1.61222 WP_003105233.1.61549 WP_003105233.1.61696 WP_003105233.1.62211 WP_003105233.1.62410 WP_003105233.1.6242 WP_003105233.1.62516 WP_003105233.1.62534 WP_003105233.1.62701 WP_003105233.1.62834 WP_003105233.1.63041 WP_003105233.1.63193 WP_003105233.1.63338 WP_003105233.1.63634 WP_003105233.1.64139 WP_003105233.1.64155 WP_003105233.1.64198 WP_003105233.1.64309 WP_003105233.1.64433 WP_003105233.1.64591 WP_003105233.1.64799 WP_003105233.1.64854 WP_003105233.1.65095 WP_003105233.1.65099 WP_003105233.1.65196 WP_003105233.1.65227 WP_003105233.1.65237 WP_003105233.1.65304 WP_003105233.1.65316 WP_003105233.1.65335 WP_003105233.1.66165 WP_003105233.1.66277 WP_003105233.1.66526 WP_003105233.1.66634 WP_003105233.1.66721 WP_003105233.1.67188 WP_003105233.1.67192 WP_003105233.1.67388 WP_003105233.1.67545 WP_003105233.1.67686 WP_003105233.1.67755 WP_003105233.1.67948 WP_003105233.1.68000 WP_003105233.1.68162 WP_003105233.1.68317 WP_003105233.1.68638 WP_003105233.1.68781 WP_003105233.1.68862 WP_003105233.1.68910 WP_003105233.1.69088 WP_003105233.1.6928 WP_003105233.1.69556 WP_003105233.1.69599 WP_003105233.1.70092 WP_003105233.1.70194 WP_003105233.1.70216 WP_003105233.1.70229 WP_003105233.1.70648 WP_003105233.1.70670 WP_003105233.1.70991 WP_003105233.1.71385 WP_003105233.1.71799 WP_003105233.1.71822 WP_003105233.1.72181 WP_003105233.1.72331 WP_003105233.1.72346 WP_003105233.1.72562 WP_003105233.1.72653 WP_003105233.1.72772 WP_003105233.1.73149 WP_003105233.1.733 WP_003105233.1.73523 WP_003105233.1.73651 WP_003105233.1.73860 WP_003105233.1.74072 WP_003105233.1.74074 WP_003105233.1.7408 WP_003105233.1.74106 WP_003105233.1.74175 WP_003105233.1.74518 WP_003105233.1.74604 WP_003105233.1.74629 WP_003105233.1.74776 WP_003105233.1.75041 WP_003105233.1.75204 WP_003105233.1.75277 WP_003105233.1.75303 WP_003105233.1.7547 WP_003105233.1.75599 WP_003105233.1.75771 WP_003105233.1.75935 WP_003105233.1.75938 WP_003105233.1.76092 WP_003105233.1.76145 WP_003105233.1.76192 WP_003105233.1.76399 WP_003105233.1.76441 WP_003105233.1.76633 WP_003105233.1.76791 WP_003105233.1.77490 WP_003105233.1.77566 WP_003105233.1.77574 WP_003105233.1.77819 WP_003105233.1.77834 WP_003105233.1.78158 WP_003105233.1.78380 WP_003105233.1.78430 WP_003105233.1.78693 WP_003105233.1.78795 WP_003105233.1.78947 WP_003105233.1.78954 WP_003105233.1.79007 WP_003105233.1.79053 WP_003105233.1.79177 WP_003105233.1.79279 WP_003105233.1.79429 WP_003105233.1.79431 WP_003105233.1.79601 WP_003105233.1.79862 WP_003105233.1.79986 WP_003105233.1.80306 WP_003105233.1.80627 WP_003105233.1.80632 WP_003105233.1.80892 WP_003105233.1.81487 WP_003105233.1.81591 WP_003105233.1.81643 WP_003105233.1.81742 WP_003105233.1.81784 WP_003105233.1.81834 WP_003105233.1.81986 WP_003105233.1.82260 WP_003105233.1.82310 WP_003105233.1.82328 WP_003105233.1.82604 WP_003105233.1.82606 WP_003105233.1.82710 WP_003105233.1.8284 WP_003105233.1.83131 WP_003105233.1.83534 WP_003105233.1.8357 WP_003105233.1.83637 WP_003105233.1.83715 WP_003105233.1.83946 WP_003105233.1.84003 WP_003105233.1.84174 WP_003105233.1.84297 WP_003105233.1.84374 WP_003105233.1.84398 WP_003105233.1.84439 WP_003105233.1.84754 WP_003105233.1.8484 WP_003105233.1.8498 WP_003105233.1.85028 WP_003105233.1.85059 WP_003105233.1.85290 WP_003105233.1.85303 WP_003105233.1.85574 WP_003105233.1.85633 WP_003105233.1.86002 WP_003105233.1.86047 WP_003105233.1.86386 WP_003105233.1.865 WP_003105233.1.86545 WP_003105233.1.86652 WP_003105233.1.867 WP_003105233.1.86785 WP_003105233.1.86947 WP_003105233.1.87163 WP_003105233.1.87182 WP_003105233.1.87316 WP_003105233.1.87390 WP_003105233.1.87435 WP_003105233.1.8749 WP_003105233.1.87648 WP_003105233.1.87763 WP_003105233.1.87981 WP_003105233.1.87987 WP_003105233.1.88308 WP_003105233.1.88578 WP_003105233.1.88679 WP_003105233.1.88680 WP_003105233.1.88750 WP_003105233.1.88900 WP_003105233.1.89245 WP_003105233.1.89276 WP_003105233.1.89330 WP_003105233.1.89409 WP_003105233.1.89440 WP_003105233.1.89669 WP_003105233.1.8976 WP_003105233.1.89867 WP_003105233.1.90056 WP_003105233.1.90141 WP_003105233.1.90189 WP_003105233.1.90224 WP_003105233.1.9056 WP_003105233.1.90655 WP_003105233.1.90940 WP_003105233.1.91093 WP_003105233.1.91161 WP_003105233.1.91360 WP_003105233.1.91416 WP_003105233.1.91431 WP_003105233.1.91563 WP_003105233.1.91585 WP_003105233.1.9182 WP_003105233.1.91846 WP_003105233.1.9191 WP_003105233.1.92314 WP_003105233.1.92587 WP_003105233.1.92624 WP_003105233.1.92769 WP_003105233.1.92839 WP_003105233.1.92894 WP_003105233.1.92930 WP_003105233.1.93144 WP_003105233.1.93148 WP_003105233.1.93446 WP_003105233.1.9349 WP_003105233.1.94031 WP_003105233.1.94814 WP_003105233.1.95460 WP_003105233.1.95774 WP_003105233.1.95994 WP_003105233.1.96008 WP_003105233.1.96041 WP_003105233.1.96434 WP_003105233.1.96506 WP_003105233.1.96702 WP_003105233.1.96967 WP_003105233.1.9722 WP_003105233.1.97877 WP_003105233.1.98260 WP_003105233.1.98433 WP_003105233.1.98573 WP_003105233.1.98693 WP_003105233.1.98788 WP_003105233.1.98926 WP_003105233.1.99461 WP_003105233.1.99662 WP_003105233.1.99746 WP_003105233.1.99757 WP_003105233.1.99930 gi|568151654|ref|YP_008940601.1| 557722.PLES_04691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]