SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151671|ref|YP_008940618.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568151671|ref|YP_008940618.1|
Domain Number - Region: 16-95
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0497
Family Cation efflux protein transmembrane domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568151671|ref|YP_008940618.1|
Sequence length 97
Comment MFS transporter [Pseudomonas aeruginosa LES431]
Sequence
MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWGAMDDFLHGLARAIGMDASLFSFVFLV
LGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH
Download sequence
Identical sequences A0A071KY64 A0A0E1ANR0 A0A0H2ZLH5 A0A157U7U7 A0A1C7BNC5 A0A1G5LV72 V6A8L0 W1MVT3
gi|568151671|ref|YP_008940618.1| gi|564950394|ref|YP_008882964.1| 208963.PA14_06390 557722.PLES_04861 WP_003084806.1.100100 WP_003084806.1.100179 WP_003084806.1.100276 WP_003084806.1.100278 WP_003084806.1.100394 WP_003084806.1.100456 WP_003084806.1.100469 WP_003084806.1.100473 WP_003084806.1.100476 WP_003084806.1.100723 WP_003084806.1.100742 WP_003084806.1.100777 WP_003084806.1.100808 WP_003084806.1.100809 WP_003084806.1.100983 WP_003084806.1.101021 WP_003084806.1.101269 WP_003084806.1.101310 WP_003084806.1.101506 WP_003084806.1.101590 WP_003084806.1.101642 WP_003084806.1.101739 WP_003084806.1.10174 WP_003084806.1.101781 WP_003084806.1.10179 WP_003084806.1.101809 WP_003084806.1.10185 WP_003084806.1.101871 WP_003084806.1.10201 WP_003084806.1.10202 WP_003084806.1.10228 WP_003084806.1.10248 WP_003084806.1.10257 WP_003084806.1.10271 WP_003084806.1.1037 WP_003084806.1.10407 WP_003084806.1.10435 WP_003084806.1.10457 WP_003084806.1.10529 WP_003084806.1.10548 WP_003084806.1.10575 WP_003084806.1.10636 WP_003084806.1.10684 WP_003084806.1.10764 WP_003084806.1.10856 WP_003084806.1.10895 WP_003084806.1.10949 WP_003084806.1.11026 WP_003084806.1.11058 WP_003084806.1.1107 WP_003084806.1.1109 WP_003084806.1.11130 WP_003084806.1.11318 WP_003084806.1.11388 WP_003084806.1.11417 WP_003084806.1.11454 WP_003084806.1.1183 WP_003084806.1.11854 WP_003084806.1.1187 WP_003084806.1.11943 WP_003084806.1.12018 WP_003084806.1.12081 WP_003084806.1.12150 WP_003084806.1.12200 WP_003084806.1.12208 WP_003084806.1.12240 WP_003084806.1.12302 WP_003084806.1.1238 WP_003084806.1.12400 WP_003084806.1.12547 WP_003084806.1.12657 WP_003084806.1.12660 WP_003084806.1.12670 WP_003084806.1.12687 WP_003084806.1.12744 WP_003084806.1.12797 WP_003084806.1.12838 WP_003084806.1.12890 WP_003084806.1.12930 WP_003084806.1.12934 WP_003084806.1.12980 WP_003084806.1.13041 WP_003084806.1.13077 WP_003084806.1.13085 WP_003084806.1.13092 WP_003084806.1.13232 WP_003084806.1.13242 WP_003084806.1.13266 WP_003084806.1.13270 WP_003084806.1.13364 WP_003084806.1.13529 WP_003084806.1.13533 WP_003084806.1.13642 WP_003084806.1.13718 WP_003084806.1.13743 WP_003084806.1.13795 WP_003084806.1.13828 WP_003084806.1.13865 WP_003084806.1.1393 WP_003084806.1.14049 WP_003084806.1.14096 WP_003084806.1.14116 WP_003084806.1.14204 WP_003084806.1.14251 WP_003084806.1.14378 WP_003084806.1.14424 WP_003084806.1.14463 WP_003084806.1.14476 WP_003084806.1.14525 WP_003084806.1.14564 WP_003084806.1.14640 WP_003084806.1.14679 WP_003084806.1.14690 WP_003084806.1.14714 WP_003084806.1.1475 WP_003084806.1.14797 WP_003084806.1.14815 WP_003084806.1.14839 WP_003084806.1.14883 WP_003084806.1.14966 WP_003084806.1.14981 WP_003084806.1.15004 WP_003084806.1.15130 WP_003084806.1.1516 WP_003084806.1.152 WP_003084806.1.15231 WP_003084806.1.15281 WP_003084806.1.15297 WP_003084806.1.15328 WP_003084806.1.15373 WP_003084806.1.15379 WP_003084806.1.15408 WP_003084806.1.15480 WP_003084806.1.15482 WP_003084806.1.15606 WP_003084806.1.15666 WP_003084806.1.15886 WP_003084806.1.15934 WP_003084806.1.16041 WP_003084806.1.16074 WP_003084806.1.16142 WP_003084806.1.16161 WP_003084806.1.162 WP_003084806.1.16239 WP_003084806.1.1646 WP_003084806.1.16660 WP_003084806.1.16694 WP_003084806.1.1670 WP_003084806.1.16751 WP_003084806.1.16788 WP_003084806.1.16801 WP_003084806.1.16808 WP_003084806.1.16811 WP_003084806.1.16895 WP_003084806.1.1704 WP_003084806.1.17108 WP_003084806.1.17155 WP_003084806.1.17162 WP_003084806.1.17177 WP_003084806.1.17189 WP_003084806.1.172 WP_003084806.1.17223 WP_003084806.1.17353 WP_003084806.1.17370 WP_003084806.1.17397 WP_003084806.1.17499 WP_003084806.1.1758 WP_003084806.1.1761 WP_003084806.1.18054 WP_003084806.1.18117 WP_003084806.1.18156 WP_003084806.1.18157 WP_003084806.1.18199 WP_003084806.1.1824 WP_003084806.1.18349 WP_003084806.1.18440 WP_003084806.1.18508 WP_003084806.1.18547 WP_003084806.1.18732 WP_003084806.1.18735 WP_003084806.1.18795 WP_003084806.1.18852 WP_003084806.1.18892 WP_003084806.1.18907 WP_003084806.1.18911 WP_003084806.1.18930 WP_003084806.1.19089 WP_003084806.1.19199 WP_003084806.1.19251 WP_003084806.1.19260 WP_003084806.1.19351 WP_003084806.1.19376 WP_003084806.1.1938 WP_003084806.1.19552 WP_003084806.1.19640 WP_003084806.1.1971 WP_003084806.1.19711 WP_003084806.1.19718 WP_003084806.1.19741 WP_003084806.1.19803 WP_003084806.1.19824 WP_003084806.1.19930 WP_003084806.1.19931 WP_003084806.1.20024 WP_003084806.1.2012 WP_003084806.1.20125 WP_003084806.1.20154 WP_003084806.1.20216 WP_003084806.1.20590 WP_003084806.1.20682 WP_003084806.1.20692 WP_003084806.1.20825 WP_003084806.1.20880 WP_003084806.1.20890 WP_003084806.1.20929 WP_003084806.1.20978 WP_003084806.1.21002 WP_003084806.1.21039 WP_003084806.1.21096 WP_003084806.1.21100 WP_003084806.1.21166 WP_003084806.1.21209 WP_003084806.1.21253 WP_003084806.1.21302 WP_003084806.1.21358 WP_003084806.1.2144 WP_003084806.1.21460 WP_003084806.1.21517 WP_003084806.1.21718 WP_003084806.1.21871 WP_003084806.1.21891 WP_003084806.1.221 WP_003084806.1.22316 WP_003084806.1.22365 WP_003084806.1.2237 WP_003084806.1.22389 WP_003084806.1.22390 WP_003084806.1.22477 WP_003084806.1.22491 WP_003084806.1.22573 WP_003084806.1.22671 WP_003084806.1.22729 WP_003084806.1.22863 WP_003084806.1.23013 WP_003084806.1.23166 WP_003084806.1.23191 WP_003084806.1.23195 WP_003084806.1.23264 WP_003084806.1.23331 WP_003084806.1.23523 WP_003084806.1.23525 WP_003084806.1.2355 WP_003084806.1.23559 WP_003084806.1.236 WP_003084806.1.23715 WP_003084806.1.23769 WP_003084806.1.23794 WP_003084806.1.23938 WP_003084806.1.23967 WP_003084806.1.24077 WP_003084806.1.24087 WP_003084806.1.24183 WP_003084806.1.24234 WP_003084806.1.24319 WP_003084806.1.24351 WP_003084806.1.24413 WP_003084806.1.2453 WP_003084806.1.24626 WP_003084806.1.2477 WP_003084806.1.24851 WP_003084806.1.24862 WP_003084806.1.24869 WP_003084806.1.24938 WP_003084806.1.24940 WP_003084806.1.25033 WP_003084806.1.25052 WP_003084806.1.25067 WP_003084806.1.25075 WP_003084806.1.251 WP_003084806.1.2511 WP_003084806.1.25142 WP_003084806.1.25179 WP_003084806.1.2530 WP_003084806.1.25328 WP_003084806.1.25344 WP_003084806.1.25600 WP_003084806.1.25641 WP_003084806.1.25675 WP_003084806.1.25695 WP_003084806.1.25834 WP_003084806.1.25903 WP_003084806.1.26010 WP_003084806.1.26025 WP_003084806.1.26042 WP_003084806.1.26428 WP_003084806.1.26463 WP_003084806.1.26473 WP_003084806.1.26553 WP_003084806.1.26681 WP_003084806.1.26682 WP_003084806.1.26705 WP_003084806.1.26740 WP_003084806.1.26816 WP_003084806.1.26841 WP_003084806.1.26862 WP_003084806.1.26906 WP_003084806.1.27028 WP_003084806.1.27039 WP_003084806.1.27073 WP_003084806.1.27107 WP_003084806.1.27211 WP_003084806.1.27218 WP_003084806.1.27259 WP_003084806.1.27288 WP_003084806.1.27549 WP_003084806.1.27687 WP_003084806.1.27772 WP_003084806.1.27825 WP_003084806.1.27837 WP_003084806.1.27933 WP_003084806.1.27939 WP_003084806.1.27966 WP_003084806.1.28175 WP_003084806.1.28193 WP_003084806.1.283 WP_003084806.1.28329 WP_003084806.1.28383 WP_003084806.1.28505 WP_003084806.1.28528 WP_003084806.1.28560 WP_003084806.1.28602 WP_003084806.1.28699 WP_003084806.1.28713 WP_003084806.1.28757 WP_003084806.1.28800 WP_003084806.1.28838 WP_003084806.1.28878 WP_003084806.1.29003 WP_003084806.1.29008 WP_003084806.1.29062 WP_003084806.1.29070 WP_003084806.1.29127 WP_003084806.1.29137 WP_003084806.1.29158 WP_003084806.1.29401 WP_003084806.1.29440 WP_003084806.1.29481 WP_003084806.1.29498 WP_003084806.1.29501 WP_003084806.1.29577 WP_003084806.1.2961 WP_003084806.1.29633 WP_003084806.1.29650 WP_003084806.1.29668 WP_003084806.1.29753 WP_003084806.1.29767 WP_003084806.1.29848 WP_003084806.1.29920 WP_003084806.1.29958 WP_003084806.1.29973 WP_003084806.1.30000 WP_003084806.1.30020 WP_003084806.1.30081 WP_003084806.1.30254 WP_003084806.1.3030 WP_003084806.1.30365 WP_003084806.1.30474 WP_003084806.1.30563 WP_003084806.1.30614 WP_003084806.1.30615 WP_003084806.1.30625 WP_003084806.1.30693 WP_003084806.1.30740 WP_003084806.1.30797 WP_003084806.1.30815 WP_003084806.1.30842 WP_003084806.1.30943 WP_003084806.1.30973 WP_003084806.1.31045 WP_003084806.1.31279 WP_003084806.1.31361 WP_003084806.1.31457 WP_003084806.1.31501 WP_003084806.1.31563 WP_003084806.1.31565 WP_003084806.1.31587 WP_003084806.1.31633 WP_003084806.1.31655 WP_003084806.1.3172 WP_003084806.1.31732 WP_003084806.1.31751 WP_003084806.1.3179 WP_003084806.1.31852 WP_003084806.1.3189 WP_003084806.1.319 WP_003084806.1.31939 WP_003084806.1.32137 WP_003084806.1.32235 WP_003084806.1.32314 WP_003084806.1.32359 WP_003084806.1.32523 WP_003084806.1.32544 WP_003084806.1.32626 WP_003084806.1.32637 WP_003084806.1.32641 WP_003084806.1.32821 WP_003084806.1.32879 WP_003084806.1.32998 WP_003084806.1.33009 WP_003084806.1.33047 WP_003084806.1.33097 WP_003084806.1.33210 WP_003084806.1.33294 WP_003084806.1.33340 WP_003084806.1.33438 WP_003084806.1.33455 WP_003084806.1.3351 WP_003084806.1.33517 WP_003084806.1.33523 WP_003084806.1.33547 WP_003084806.1.33549 WP_003084806.1.33669 WP_003084806.1.3368 WP_003084806.1.33728 WP_003084806.1.33774 WP_003084806.1.33801 WP_003084806.1.33814 WP_003084806.1.33822 WP_003084806.1.33824 WP_003084806.1.33833 WP_003084806.1.3385 WP_003084806.1.33945 WP_003084806.1.34136 WP_003084806.1.34143 WP_003084806.1.34150 WP_003084806.1.34180 WP_003084806.1.34191 WP_003084806.1.34203 WP_003084806.1.34306 WP_003084806.1.34317 WP_003084806.1.34324 WP_003084806.1.3436 WP_003084806.1.34461 WP_003084806.1.34472 WP_003084806.1.3452 WP_003084806.1.34556 WP_003084806.1.34568 WP_003084806.1.34583 WP_003084806.1.34625 WP_003084806.1.34670 WP_003084806.1.34689 WP_003084806.1.34784 WP_003084806.1.34821 WP_003084806.1.34832 WP_003084806.1.34836 WP_003084806.1.34876 WP_003084806.1.34878 WP_003084806.1.34922 WP_003084806.1.34942 WP_003084806.1.35104 WP_003084806.1.35149 WP_003084806.1.35231 WP_003084806.1.35281 WP_003084806.1.3531 WP_003084806.1.35325 WP_003084806.1.35353 WP_003084806.1.3540 WP_003084806.1.35442 WP_003084806.1.35512 WP_003084806.1.35529 WP_003084806.1.3555 WP_003084806.1.35639 WP_003084806.1.35641 WP_003084806.1.3568 WP_003084806.1.35762 WP_003084806.1.35822 WP_003084806.1.35857 WP_003084806.1.35968 WP_003084806.1.35984 WP_003084806.1.36064 WP_003084806.1.36121 WP_003084806.1.36148 WP_003084806.1.36266 WP_003084806.1.36267 WP_003084806.1.36285 WP_003084806.1.36378 WP_003084806.1.36487 WP_003084806.1.3662 WP_003084806.1.36665 WP_003084806.1.36708 WP_003084806.1.3672 WP_003084806.1.36756 WP_003084806.1.36781 WP_003084806.1.37050 WP_003084806.1.37172 WP_003084806.1.37208 WP_003084806.1.373 WP_003084806.1.37319 WP_003084806.1.37366 WP_003084806.1.37416 WP_003084806.1.3742 WP_003084806.1.37500 WP_003084806.1.37512 WP_003084806.1.37571 WP_003084806.1.3768 WP_003084806.1.37698 WP_003084806.1.37703 WP_003084806.1.3773 WP_003084806.1.3781 WP_003084806.1.3792 WP_003084806.1.38003 WP_003084806.1.38023 WP_003084806.1.38060 WP_003084806.1.3818 WP_003084806.1.3821 WP_003084806.1.3833 WP_003084806.1.38335 WP_003084806.1.38337 WP_003084806.1.38406 WP_003084806.1.38430 WP_003084806.1.38450 WP_003084806.1.38502 WP_003084806.1.38510 WP_003084806.1.38582 WP_003084806.1.38587 WP_003084806.1.3870 WP_003084806.1.38706 WP_003084806.1.38727 WP_003084806.1.38816 WP_003084806.1.38834 WP_003084806.1.3887 WP_003084806.1.38932 WP_003084806.1.39088 WP_003084806.1.39122 WP_003084806.1.3943 WP_003084806.1.39452 WP_003084806.1.39458 WP_003084806.1.39537 WP_003084806.1.39765 WP_003084806.1.39920 WP_003084806.1.39949 WP_003084806.1.3998 WP_003084806.1.39989 WP_003084806.1.40059 WP_003084806.1.40115 WP_003084806.1.40135 WP_003084806.1.40237 WP_003084806.1.40271 WP_003084806.1.40419 WP_003084806.1.40442 WP_003084806.1.40513 WP_003084806.1.40541 WP_003084806.1.40546 WP_003084806.1.4058 WP_003084806.1.40595 WP_003084806.1.40703 WP_003084806.1.40874 WP_003084806.1.40984 WP_003084806.1.40993 WP_003084806.1.41110 WP_003084806.1.41137 WP_003084806.1.41199 WP_003084806.1.41290 WP_003084806.1.41291 WP_003084806.1.41384 WP_003084806.1.41412 WP_003084806.1.41429 WP_003084806.1.41487 WP_003084806.1.41492 WP_003084806.1.4156 WP_003084806.1.41618 WP_003084806.1.41624 WP_003084806.1.41625 WP_003084806.1.41692 WP_003084806.1.41703 WP_003084806.1.41725 WP_003084806.1.41846 WP_003084806.1.41939 WP_003084806.1.4196 WP_003084806.1.42 WP_003084806.1.42047 WP_003084806.1.42259 WP_003084806.1.42316 WP_003084806.1.42381 WP_003084806.1.42388 WP_003084806.1.42411 WP_003084806.1.42499 WP_003084806.1.42508 WP_003084806.1.42690 WP_003084806.1.42696 WP_003084806.1.42723 WP_003084806.1.4273 WP_003084806.1.42754 WP_003084806.1.42778 WP_003084806.1.42789 WP_003084806.1.42854 WP_003084806.1.42870 WP_003084806.1.42917 WP_003084806.1.42946 WP_003084806.1.42973 WP_003084806.1.43022 WP_003084806.1.43024 WP_003084806.1.43026 WP_003084806.1.43106 WP_003084806.1.43107 WP_003084806.1.43212 WP_003084806.1.43245 WP_003084806.1.43286 WP_003084806.1.43315 WP_003084806.1.43326 WP_003084806.1.43356 WP_003084806.1.43662 WP_003084806.1.43673 WP_003084806.1.43696 WP_003084806.1.43729 WP_003084806.1.43756 WP_003084806.1.43802 WP_003084806.1.43811 WP_003084806.1.4397 WP_003084806.1.43998 WP_003084806.1.44213 WP_003084806.1.44269 WP_003084806.1.44373 WP_003084806.1.44486 WP_003084806.1.44552 WP_003084806.1.44563 WP_003084806.1.44565 WP_003084806.1.44725 WP_003084806.1.44739 WP_003084806.1.44804 WP_003084806.1.44870 WP_003084806.1.4493 WP_003084806.1.45090 WP_003084806.1.4522 WP_003084806.1.45228 WP_003084806.1.45298 WP_003084806.1.45306 WP_003084806.1.45312 WP_003084806.1.45353 WP_003084806.1.45358 WP_003084806.1.45485 WP_003084806.1.45604 WP_003084806.1.45611 WP_003084806.1.45635 WP_003084806.1.45636 WP_003084806.1.45678 WP_003084806.1.45700 WP_003084806.1.45711 WP_003084806.1.45818 WP_003084806.1.45837 WP_003084806.1.45920 WP_003084806.1.45934 WP_003084806.1.45946 WP_003084806.1.45961 WP_003084806.1.46010 WP_003084806.1.46152 WP_003084806.1.46200 WP_003084806.1.46306 WP_003084806.1.4640 WP_003084806.1.46623 WP_003084806.1.46846 WP_003084806.1.46935 WP_003084806.1.4699 WP_003084806.1.47150 WP_003084806.1.47158 WP_003084806.1.47251 WP_003084806.1.47296 WP_003084806.1.47314 WP_003084806.1.47374 WP_003084806.1.47469 WP_003084806.1.47480 WP_003084806.1.47551 WP_003084806.1.47598 WP_003084806.1.47774 WP_003084806.1.47930 WP_003084806.1.47934 WP_003084806.1.48024 WP_003084806.1.48094 WP_003084806.1.48178 WP_003084806.1.48321 WP_003084806.1.48334 WP_003084806.1.4836 WP_003084806.1.48382 WP_003084806.1.48472 WP_003084806.1.48487 WP_003084806.1.48545 WP_003084806.1.48576 WP_003084806.1.48579 WP_003084806.1.48747 WP_003084806.1.48810 WP_003084806.1.48840 WP_003084806.1.48851 WP_003084806.1.48870 WP_003084806.1.48961 WP_003084806.1.49108 WP_003084806.1.4913 WP_003084806.1.49135 WP_003084806.1.49184 WP_003084806.1.49244 WP_003084806.1.49266 WP_003084806.1.49277 WP_003084806.1.49286 WP_003084806.1.49293 WP_003084806.1.49360 WP_003084806.1.49500 WP_003084806.1.49557 WP_003084806.1.49806 WP_003084806.1.49842 WP_003084806.1.49922 WP_003084806.1.49948 WP_003084806.1.49988 WP_003084806.1.50180 WP_003084806.1.50232 WP_003084806.1.50450 WP_003084806.1.50459 WP_003084806.1.50567 WP_003084806.1.50665 WP_003084806.1.50668 WP_003084806.1.50691 WP_003084806.1.50783 WP_003084806.1.50814 WP_003084806.1.50922 WP_003084806.1.51035 WP_003084806.1.51136 WP_003084806.1.51141 WP_003084806.1.51173 WP_003084806.1.51273 WP_003084806.1.5132 WP_003084806.1.51457 WP_003084806.1.51472 WP_003084806.1.51501 WP_003084806.1.51549 WP_003084806.1.51727 WP_003084806.1.51733 WP_003084806.1.51847 WP_003084806.1.51889 WP_003084806.1.51917 WP_003084806.1.51928 WP_003084806.1.51957 WP_003084806.1.52043 WP_003084806.1.52146 WP_003084806.1.52152 WP_003084806.1.52212 WP_003084806.1.5226 WP_003084806.1.52326 WP_003084806.1.5235 WP_003084806.1.52372 WP_003084806.1.52403 WP_003084806.1.52409 WP_003084806.1.52449 WP_003084806.1.52500 WP_003084806.1.52591 WP_003084806.1.5260 WP_003084806.1.52690 WP_003084806.1.52697 WP_003084806.1.52728 WP_003084806.1.52790 WP_003084806.1.52810 WP_003084806.1.52850 WP_003084806.1.5289 WP_003084806.1.52939 WP_003084806.1.5294 WP_003084806.1.53038 WP_003084806.1.53070 WP_003084806.1.53072 WP_003084806.1.53267 WP_003084806.1.53371 WP_003084806.1.53414 WP_003084806.1.53427 WP_003084806.1.53528 WP_003084806.1.53586 WP_003084806.1.53663 WP_003084806.1.53678 WP_003084806.1.53826 WP_003084806.1.5388 WP_003084806.1.53946 WP_003084806.1.53951 WP_003084806.1.5399 WP_003084806.1.54003 WP_003084806.1.54076 WP_003084806.1.54078 WP_003084806.1.54133 WP_003084806.1.54140 WP_003084806.1.5420 WP_003084806.1.54248 WP_003084806.1.54293 WP_003084806.1.54354 WP_003084806.1.54462 WP_003084806.1.54497 WP_003084806.1.54571 WP_003084806.1.54742 WP_003084806.1.55 WP_003084806.1.55387 WP_003084806.1.55400 WP_003084806.1.55445 WP_003084806.1.55478 WP_003084806.1.55543 WP_003084806.1.55813 WP_003084806.1.55976 WP_003084806.1.56013 WP_003084806.1.56145 WP_003084806.1.56171 WP_003084806.1.56187 WP_003084806.1.56188 WP_003084806.1.56348 WP_003084806.1.56442 WP_003084806.1.56465 WP_003084806.1.56475 WP_003084806.1.56623 WP_003084806.1.56626 WP_003084806.1.56632 WP_003084806.1.56768 WP_003084806.1.56797 WP_003084806.1.56808 WP_003084806.1.56837 WP_003084806.1.56864 WP_003084806.1.56896 WP_003084806.1.57005 WP_003084806.1.57020 WP_003084806.1.57065 WP_003084806.1.57140 WP_003084806.1.5731 WP_003084806.1.57339 WP_003084806.1.57369 WP_003084806.1.57417 WP_003084806.1.57460 WP_003084806.1.57477 WP_003084806.1.57480 WP_003084806.1.57532 WP_003084806.1.57548 WP_003084806.1.57566 WP_003084806.1.57728 WP_003084806.1.57792 WP_003084806.1.57839 WP_003084806.1.57841 WP_003084806.1.57853 WP_003084806.1.57921 WP_003084806.1.57966 WP_003084806.1.58019 WP_003084806.1.58056 WP_003084806.1.58155 WP_003084806.1.58162 WP_003084806.1.58200 WP_003084806.1.58294 WP_003084806.1.58360 WP_003084806.1.58417 WP_003084806.1.58436 WP_003084806.1.5850 WP_003084806.1.58510 WP_003084806.1.58527 WP_003084806.1.5856 WP_003084806.1.58581 WP_003084806.1.5869 WP_003084806.1.58785 WP_003084806.1.58800 WP_003084806.1.58838 WP_003084806.1.58845 WP_003084806.1.5889 WP_003084806.1.58944 WP_003084806.1.58952 WP_003084806.1.5897 WP_003084806.1.59076 WP_003084806.1.59099 WP_003084806.1.59156 WP_003084806.1.59158 WP_003084806.1.59212 WP_003084806.1.59249 WP_003084806.1.59250 WP_003084806.1.59288 WP_003084806.1.59339 WP_003084806.1.5937 WP_003084806.1.59376 WP_003084806.1.59385 WP_003084806.1.594 WP_003084806.1.59469 WP_003084806.1.59563 WP_003084806.1.59688 WP_003084806.1.59759 WP_003084806.1.59797 WP_003084806.1.59870 WP_003084806.1.59943 WP_003084806.1.60062 WP_003084806.1.60079 WP_003084806.1.60082 WP_003084806.1.60084 WP_003084806.1.60206 WP_003084806.1.60261 WP_003084806.1.60347 WP_003084806.1.60364 WP_003084806.1.60396 WP_003084806.1.60415 WP_003084806.1.60467 WP_003084806.1.60472 WP_003084806.1.60509 WP_003084806.1.60600 WP_003084806.1.60603 WP_003084806.1.60679 WP_003084806.1.607 WP_003084806.1.60850 WP_003084806.1.60970 WP_003084806.1.61122 WP_003084806.1.61191 WP_003084806.1.61269 WP_003084806.1.61288 WP_003084806.1.61294 WP_003084806.1.61299 WP_003084806.1.61366 WP_003084806.1.61431 WP_003084806.1.61493 WP_003084806.1.61549 WP_003084806.1.61589 WP_003084806.1.616 WP_003084806.1.61696 WP_003084806.1.6173 WP_003084806.1.61943 WP_003084806.1.62035 WP_003084806.1.62396 WP_003084806.1.6242 WP_003084806.1.62516 WP_003084806.1.62534 WP_003084806.1.626 WP_003084806.1.62604 WP_003084806.1.62635 WP_003084806.1.62688 WP_003084806.1.62701 WP_003084806.1.62703 WP_003084806.1.62704 WP_003084806.1.62708 WP_003084806.1.62716 WP_003084806.1.62772 WP_003084806.1.6283 WP_003084806.1.62838 WP_003084806.1.62961 WP_003084806.1.62977 WP_003084806.1.63124 WP_003084806.1.63338 WP_003084806.1.63369 WP_003084806.1.63401 WP_003084806.1.63591 WP_003084806.1.63634 WP_003084806.1.63659 WP_003084806.1.63739 WP_003084806.1.63784 WP_003084806.1.63929 WP_003084806.1.63941 WP_003084806.1.63995 WP_003084806.1.64139 WP_003084806.1.64212 WP_003084806.1.64340 WP_003084806.1.6450 WP_003084806.1.64544 WP_003084806.1.64603 WP_003084806.1.64605 WP_003084806.1.6461 WP_003084806.1.64611 WP_003084806.1.64885 WP_003084806.1.64886 WP_003084806.1.64983 WP_003084806.1.65009 WP_003084806.1.65092 WP_003084806.1.65099 WP_003084806.1.65196 WP_003084806.1.65197 WP_003084806.1.65227 WP_003084806.1.65237 WP_003084806.1.65247 WP_003084806.1.65285 WP_003084806.1.65312 WP_003084806.1.65316 WP_003084806.1.65334 WP_003084806.1.65335 WP_003084806.1.65337 WP_003084806.1.65457 WP_003084806.1.65478 WP_003084806.1.65588 WP_003084806.1.65632 WP_003084806.1.65679 WP_003084806.1.65740 WP_003084806.1.65779 WP_003084806.1.65867 WP_003084806.1.66062 WP_003084806.1.66088 WP_003084806.1.66155 WP_003084806.1.66165 WP_003084806.1.66345 WP_003084806.1.66364 WP_003084806.1.66371 WP_003084806.1.66526 WP_003084806.1.66563 WP_003084806.1.66634 WP_003084806.1.66693 WP_003084806.1.66721 WP_003084806.1.66931 WP_003084806.1.66945 WP_003084806.1.66982 WP_003084806.1.67010 WP_003084806.1.67124 WP_003084806.1.67192 WP_003084806.1.6734 WP_003084806.1.67388 WP_003084806.1.67489 WP_003084806.1.67506 WP_003084806.1.6768 WP_003084806.1.67686 WP_003084806.1.67874 WP_003084806.1.67875 WP_003084806.1.67899 WP_003084806.1.67937 WP_003084806.1.67948 WP_003084806.1.6796 WP_003084806.1.68000 WP_003084806.1.6808 WP_003084806.1.68162 WP_003084806.1.68172 WP_003084806.1.68183 WP_003084806.1.68194 WP_003084806.1.68317 WP_003084806.1.68446 WP_003084806.1.68448 WP_003084806.1.68472 WP_003084806.1.68499 WP_003084806.1.68541 WP_003084806.1.68561 WP_003084806.1.68638 WP_003084806.1.68790 WP_003084806.1.68800 WP_003084806.1.68802 WP_003084806.1.68862 WP_003084806.1.68881 WP_003084806.1.68979 WP_003084806.1.69088 WP_003084806.1.6911 WP_003084806.1.69209 WP_003084806.1.6931 WP_003084806.1.6937 WP_003084806.1.69411 WP_003084806.1.69534 WP_003084806.1.69599 WP_003084806.1.69788 WP_003084806.1.69791 WP_003084806.1.69819 WP_003084806.1.69834 WP_003084806.1.70098 WP_003084806.1.70138 WP_003084806.1.70168 WP_003084806.1.70460 WP_003084806.1.70537 WP_003084806.1.70561 WP_003084806.1.70583 WP_003084806.1.70650 WP_003084806.1.70670 WP_003084806.1.70677 WP_003084806.1.70693 WP_003084806.1.70831 WP_003084806.1.70991 WP_003084806.1.71141 WP_003084806.1.71203 WP_003084806.1.71234 WP_003084806.1.71249 WP_003084806.1.71254 WP_003084806.1.71290 WP_003084806.1.71346 WP_003084806.1.71412 WP_003084806.1.71610 WP_003084806.1.7163 WP_003084806.1.71738 WP_003084806.1.71806 WP_003084806.1.71822 WP_003084806.1.71862 WP_003084806.1.71866 WP_003084806.1.71891 WP_003084806.1.72149 WP_003084806.1.72183 WP_003084806.1.7219 WP_003084806.1.72323 WP_003084806.1.72331 WP_003084806.1.72346 WP_003084806.1.72378 WP_003084806.1.72447 WP_003084806.1.72458 WP_003084806.1.72477 WP_003084806.1.72562 WP_003084806.1.72662 WP_003084806.1.72669 WP_003084806.1.72727 WP_003084806.1.72772 WP_003084806.1.72782 WP_003084806.1.72845 WP_003084806.1.72920 WP_003084806.1.73035 WP_003084806.1.7308 WP_003084806.1.73135 WP_003084806.1.73149 WP_003084806.1.73172 WP_003084806.1.73192 WP_003084806.1.7329 WP_003084806.1.73490 WP_003084806.1.73541 WP_003084806.1.73601 WP_003084806.1.73651 WP_003084806.1.73719 WP_003084806.1.7377 WP_003084806.1.73791 WP_003084806.1.73860 WP_003084806.1.73889 WP_003084806.1.73941 WP_003084806.1.74000 WP_003084806.1.74074 WP_003084806.1.7408 WP_003084806.1.74106 WP_003084806.1.74167 WP_003084806.1.74175 WP_003084806.1.74182 WP_003084806.1.74264 WP_003084806.1.74268 WP_003084806.1.74281 WP_003084806.1.74287 WP_003084806.1.74326 WP_003084806.1.7445 WP_003084806.1.74475 WP_003084806.1.7448 WP_003084806.1.74518 WP_003084806.1.7456 WP_003084806.1.74629 WP_003084806.1.74637 WP_003084806.1.74685 WP_003084806.1.74772 WP_003084806.1.74776 WP_003084806.1.74878 WP_003084806.1.74941 WP_003084806.1.74948 WP_003084806.1.74958 WP_003084806.1.7501 WP_003084806.1.75041 WP_003084806.1.75119 WP_003084806.1.75277 WP_003084806.1.75303 WP_003084806.1.75389 WP_003084806.1.75431 WP_003084806.1.7547 WP_003084806.1.75580 WP_003084806.1.75603 WP_003084806.1.7568 WP_003084806.1.75756 WP_003084806.1.75771 WP_003084806.1.75826 WP_003084806.1.75860 WP_003084806.1.75935 WP_003084806.1.75938 WP_003084806.1.75947 WP_003084806.1.76077 WP_003084806.1.76141 WP_003084806.1.76192 WP_003084806.1.76322 WP_003084806.1.76383 WP_003084806.1.76399 WP_003084806.1.76543 WP_003084806.1.76633 WP_003084806.1.7666 WP_003084806.1.76775 WP_003084806.1.76861 WP_003084806.1.76922 WP_003084806.1.76985 WP_003084806.1.77238 WP_003084806.1.77286 WP_003084806.1.77442 WP_003084806.1.77476 WP_003084806.1.77574 WP_003084806.1.77686 WP_003084806.1.77750 WP_003084806.1.7779 WP_003084806.1.77834 WP_003084806.1.77913 WP_003084806.1.78104 WP_003084806.1.78118 WP_003084806.1.78134 WP_003084806.1.78148 WP_003084806.1.78158 WP_003084806.1.78288 WP_003084806.1.7840 WP_003084806.1.78409 WP_003084806.1.78425 WP_003084806.1.78430 WP_003084806.1.78437 WP_003084806.1.78599 WP_003084806.1.78669 WP_003084806.1.78795 WP_003084806.1.788 WP_003084806.1.78926 WP_003084806.1.78947 WP_003084806.1.78986 WP_003084806.1.7899 WP_003084806.1.79003 WP_003084806.1.79007 WP_003084806.1.79060 WP_003084806.1.79177 WP_003084806.1.79193 WP_003084806.1.79256 WP_003084806.1.79286 WP_003084806.1.79357 WP_003084806.1.79364 WP_003084806.1.79421 WP_003084806.1.79431 WP_003084806.1.7945 WP_003084806.1.79507 WP_003084806.1.79544 WP_003084806.1.79631 WP_003084806.1.79699 WP_003084806.1.79754 WP_003084806.1.79862 WP_003084806.1.79883 WP_003084806.1.799 WP_003084806.1.79902 WP_003084806.1.79908 WP_003084806.1.8 WP_003084806.1.80068 WP_003084806.1.80087 WP_003084806.1.80102 WP_003084806.1.8013 WP_003084806.1.80174 WP_003084806.1.80258 WP_003084806.1.8028 WP_003084806.1.8038 WP_003084806.1.80411 WP_003084806.1.80454 WP_003084806.1.80535 WP_003084806.1.80572 WP_003084806.1.80627 WP_003084806.1.80632 WP_003084806.1.80644 WP_003084806.1.80683 WP_003084806.1.80715 WP_003084806.1.80720 WP_003084806.1.80785 WP_003084806.1.80846 WP_003084806.1.80880 WP_003084806.1.80910 WP_003084806.1.80926 WP_003084806.1.80929 WP_003084806.1.80969 WP_003084806.1.81081 WP_003084806.1.81082 WP_003084806.1.8110 WP_003084806.1.81237 WP_003084806.1.81338 WP_003084806.1.81349 WP_003084806.1.81368 WP_003084806.1.81380 WP_003084806.1.8141 WP_003084806.1.81426 WP_003084806.1.81470 WP_003084806.1.81482 WP_003084806.1.81487 WP_003084806.1.81581 WP_003084806.1.81591 WP_003084806.1.81622 WP_003084806.1.81643 WP_003084806.1.81748 WP_003084806.1.81802 WP_003084806.1.81816 WP_003084806.1.81834 WP_003084806.1.81856 WP_003084806.1.81874 WP_003084806.1.81927 WP_003084806.1.81957 WP_003084806.1.81960 WP_003084806.1.82117 WP_003084806.1.82127 WP_003084806.1.82178 WP_003084806.1.82260 WP_003084806.1.8227 WP_003084806.1.82328 WP_003084806.1.82334 WP_003084806.1.8238 WP_003084806.1.82442 WP_003084806.1.82487 WP_003084806.1.82580 WP_003084806.1.82604 WP_003084806.1.82620 WP_003084806.1.82686 WP_003084806.1.82710 WP_003084806.1.82798 WP_003084806.1.82810 WP_003084806.1.8284 WP_003084806.1.82887 WP_003084806.1.82936 WP_003084806.1.83025 WP_003084806.1.83267 WP_003084806.1.83317 WP_003084806.1.83374 WP_003084806.1.83440 WP_003084806.1.83460 WP_003084806.1.83463 WP_003084806.1.83503 WP_003084806.1.8351 WP_003084806.1.8353 WP_003084806.1.83540 WP_003084806.1.83637 WP_003084806.1.83673 WP_003084806.1.83698 WP_003084806.1.83871 WP_003084806.1.83937 WP_003084806.1.84003 WP_003084806.1.84138 WP_003084806.1.84162 WP_003084806.1.84177 WP_003084806.1.84178 WP_003084806.1.84203 WP_003084806.1.84374 WP_003084806.1.84398 WP_003084806.1.84439 WP_003084806.1.84471 WP_003084806.1.84526 WP_003084806.1.84538 WP_003084806.1.84558 WP_003084806.1.84684 WP_003084806.1.84825 WP_003084806.1.8484 WP_003084806.1.84865 WP_003084806.1.84937 WP_003084806.1.84946 WP_003084806.1.8498 WP_003084806.1.85018 WP_003084806.1.85028 WP_003084806.1.85150 WP_003084806.1.85220 WP_003084806.1.85298 WP_003084806.1.85311 WP_003084806.1.85357 WP_003084806.1.85446 WP_003084806.1.85453 WP_003084806.1.85574 WP_003084806.1.85638 WP_003084806.1.85920 WP_003084806.1.85978 WP_003084806.1.86002 WP_003084806.1.86047 WP_003084806.1.86055 WP_003084806.1.86125 WP_003084806.1.86182 WP_003084806.1.86243 WP_003084806.1.86287 WP_003084806.1.86386 WP_003084806.1.86432 WP_003084806.1.8645 WP_003084806.1.86506 WP_003084806.1.86545 WP_003084806.1.86554 WP_003084806.1.86595 WP_003084806.1.86652 WP_003084806.1.86665 WP_003084806.1.86708 WP_003084806.1.86733 WP_003084806.1.86774 WP_003084806.1.86780 WP_003084806.1.86796 WP_003084806.1.86813 WP_003084806.1.86822 WP_003084806.1.8693 WP_003084806.1.86947 WP_003084806.1.86970 WP_003084806.1.87104 WP_003084806.1.87163 WP_003084806.1.87183 WP_003084806.1.8727 WP_003084806.1.87316 WP_003084806.1.87390 WP_003084806.1.87435 WP_003084806.1.87463 WP_003084806.1.87547 WP_003084806.1.8777 WP_003084806.1.8785 WP_003084806.1.87877 WP_003084806.1.87888 WP_003084806.1.87970 WP_003084806.1.87975 WP_003084806.1.87981 WP_003084806.1.87987 WP_003084806.1.88308 WP_003084806.1.88360 WP_003084806.1.88388 WP_003084806.1.8852 WP_003084806.1.88540 WP_003084806.1.88550 WP_003084806.1.88605 WP_003084806.1.88679 WP_003084806.1.88680 WP_003084806.1.88796 WP_003084806.1.889 WP_003084806.1.88900 WP_003084806.1.88949 WP_003084806.1.88969 WP_003084806.1.89083 WP_003084806.1.89234 WP_003084806.1.89245 WP_003084806.1.89266 WP_003084806.1.89330 WP_003084806.1.89434 WP_003084806.1.89440 WP_003084806.1.89480 WP_003084806.1.89523 WP_003084806.1.8976 WP_003084806.1.89867 WP_003084806.1.89871 WP_003084806.1.89992 WP_003084806.1.90024 WP_003084806.1.90110 WP_003084806.1.90141 WP_003084806.1.90150 WP_003084806.1.90189 WP_003084806.1.90224 WP_003084806.1.90225 WP_003084806.1.90268 WP_003084806.1.90272 WP_003084806.1.90770 WP_003084806.1.90940 WP_003084806.1.90999 WP_003084806.1.91012 WP_003084806.1.91093 WP_003084806.1.91236 WP_003084806.1.91281 WP_003084806.1.91307 WP_003084806.1.91336 WP_003084806.1.91360 WP_003084806.1.91392 WP_003084806.1.91431 WP_003084806.1.91438 WP_003084806.1.91467 WP_003084806.1.91527 WP_003084806.1.91563 WP_003084806.1.91796 WP_003084806.1.91803 WP_003084806.1.91838 WP_003084806.1.91846 WP_003084806.1.91860 WP_003084806.1.91862 WP_003084806.1.91882 WP_003084806.1.9191 WP_003084806.1.91943 WP_003084806.1.92043 WP_003084806.1.9219 WP_003084806.1.92321 WP_003084806.1.92357 WP_003084806.1.92454 WP_003084806.1.92587 WP_003084806.1.92594 WP_003084806.1.92624 WP_003084806.1.92630 WP_003084806.1.92642 WP_003084806.1.9272 WP_003084806.1.92759 WP_003084806.1.92769 WP_003084806.1.92847 WP_003084806.1.92894 WP_003084806.1.93001 WP_003084806.1.93130 WP_003084806.1.93144 WP_003084806.1.93196 WP_003084806.1.93250 WP_003084806.1.93264 WP_003084806.1.93446 WP_003084806.1.93498 WP_003084806.1.93520 WP_003084806.1.93547 WP_003084806.1.93562 WP_003084806.1.93568 WP_003084806.1.93848 WP_003084806.1.93889 WP_003084806.1.93897 WP_003084806.1.94031 WP_003084806.1.94065 WP_003084806.1.94078 WP_003084806.1.94136 WP_003084806.1.94174 WP_003084806.1.94211 WP_003084806.1.94230 WP_003084806.1.94243 WP_003084806.1.94285 WP_003084806.1.94288 WP_003084806.1.94333 WP_003084806.1.94349 WP_003084806.1.9444 WP_003084806.1.94450 WP_003084806.1.94732 WP_003084806.1.94742 WP_003084806.1.94814 WP_003084806.1.94818 WP_003084806.1.94856 WP_003084806.1.94874 WP_003084806.1.94881 WP_003084806.1.94896 WP_003084806.1.94943 WP_003084806.1.95217 WP_003084806.1.95305 WP_003084806.1.95324 WP_003084806.1.95354 WP_003084806.1.95359 WP_003084806.1.95460 WP_003084806.1.95536 WP_003084806.1.95638 WP_003084806.1.95668 WP_003084806.1.95745 WP_003084806.1.95751 WP_003084806.1.95782 WP_003084806.1.95959 WP_003084806.1.95999 WP_003084806.1.96008 WP_003084806.1.9604 WP_003084806.1.96041 WP_003084806.1.96058 WP_003084806.1.961 WP_003084806.1.96193 WP_003084806.1.96357 WP_003084806.1.96384 WP_003084806.1.96452 WP_003084806.1.96506 WP_003084806.1.96667 WP_003084806.1.96702 WP_003084806.1.96714 WP_003084806.1.96863 WP_003084806.1.96880 WP_003084806.1.9706 WP_003084806.1.97126 WP_003084806.1.97204 WP_003084806.1.9722 WP_003084806.1.97377 WP_003084806.1.97461 WP_003084806.1.97488 WP_003084806.1.97499 WP_003084806.1.97503 WP_003084806.1.97521 WP_003084806.1.97583 WP_003084806.1.977 WP_003084806.1.97784 WP_003084806.1.97826 WP_003084806.1.97877 WP_003084806.1.98111 WP_003084806.1.98276 WP_003084806.1.98308 WP_003084806.1.9845 WP_003084806.1.985 WP_003084806.1.98515 WP_003084806.1.98672 WP_003084806.1.98693 WP_003084806.1.98718 WP_003084806.1.9885 WP_003084806.1.98873 WP_003084806.1.98907 WP_003084806.1.98926 WP_003084806.1.98963 WP_003084806.1.99065 WP_003084806.1.99068 WP_003084806.1.99214 WP_003084806.1.99293 WP_003084806.1.99378 WP_003084806.1.99389 WP_003084806.1.99443 WP_003084806.1.99461 WP_003084806.1.9951 WP_003084806.1.99516 WP_003084806.1.99647 WP_003084806.1.99654 WP_003084806.1.99757 WP_003084806.1.99772 WP_003084806.1.9989 gi|386068598|ref|YP_005983902.1| gi|116054219|ref|YP_788663.1| gi|218889230|ref|YP_002438094.1| gi|478476695|ref|YP_007707346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]