SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151728|ref|YP_008940675.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151728|ref|YP_008940675.1|
Domain Number 1 Region: 305-431
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.62e-24
Family Flavohemoglobin, C-terminal domain 0.076
Further Details:      
 
Domain Number 2 Region: 211-302
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.48e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568151728|ref|YP_008940675.1|
Sequence length 434
Comment reductase [Pseudomonas aeruginosa LES431]
Sequence
MKLLWGVLAAALAAWGLTLAVDPPASLDIWVVRKQAILLTGVASFALMSLIMLLAVRPVW
LEKPLDGLDRMYRLHKWAGILAIVLGLLHYLLELAGPWLAGIVGKPVKGPRVETFLDVFR
GSAKELGEWSAWILGGMLLITLWQRFPYHLWRYVHKALALVYLVLAFHSVVLAPASYWSQ
PAGWLVAACALLGSACALLSLSGRIGRTRRHAGVVTAVERHGESLLEVTCRLQGDWSHRA
GQFAFLTCDRLEGAHPFTIASADRGCGEVRFSIKALGDYTRRLQDNLEVGARVEVEGPYG
CFDFRRGLAGRQVWVAAGIGVTPFIAWLESLQAAPESAPSVELHYCVRNSQEALFAGRLR
ELCEHLPSVTLHIRYSDEQGKPQAAQLGVLKSAEGRWPSVWFCGPQGLADSLRRDLRRQG
MPLRLFHQEAFRMR
Download sequence
Identical sequences A0A1E9CHT1 A0A241XP36
gi|568151728|ref|YP_008940675.1| 557722.PLES_05431 WP_003142758.1.100071 WP_003142758.1.100420 WP_003142758.1.100473 WP_003142758.1.100742 WP_003142758.1.100810 WP_003142758.1.100995 WP_003142758.1.101712 WP_003142758.1.10185 WP_003142758.1.10202 WP_003142758.1.102045 WP_003142758.1.10228 WP_003142758.1.10419 WP_003142758.1.10513 WP_003142758.1.10572 WP_003142758.1.10641 WP_003142758.1.11026 WP_003142758.1.11058 WP_003142758.1.11077 WP_003142758.1.11454 WP_003142758.1.11569 WP_003142758.1.11653 WP_003142758.1.11744 WP_003142758.1.1180 WP_003142758.1.11847 WP_003142758.1.1187 WP_003142758.1.11943 WP_003142758.1.12482 WP_003142758.1.12873 WP_003142758.1.12970 WP_003142758.1.12980 WP_003142758.1.13 WP_003142758.1.1305 WP_003142758.1.13057 WP_003142758.1.13232 WP_003142758.1.1356 WP_003142758.1.1362 WP_003142758.1.13622 WP_003142758.1.13758 WP_003142758.1.13765 WP_003142758.1.14096 WP_003142758.1.14378 WP_003142758.1.14714 WP_003142758.1.1475 WP_003142758.1.14820 WP_003142758.1.15004 WP_003142758.1.15231 WP_003142758.1.15379 WP_003142758.1.15474 WP_003142758.1.15485 WP_003142758.1.15692 WP_003142758.1.15886 WP_003142758.1.15934 WP_003142758.1.16041 WP_003142758.1.16109 WP_003142758.1.16142 WP_003142758.1.1670 WP_003142758.1.1671 WP_003142758.1.16788 WP_003142758.1.16801 WP_003142758.1.16895 WP_003142758.1.17155 WP_003142758.1.1739 WP_003142758.1.17566 WP_003142758.1.17697 WP_003142758.1.17883 WP_003142758.1.17890 WP_003142758.1.18735 WP_003142758.1.190 WP_003142758.1.19260 WP_003142758.1.19711 WP_003142758.1.19771 WP_003142758.1.20024 WP_003142758.1.20134 WP_003142758.1.20682 WP_003142758.1.20744 WP_003142758.1.20764 WP_003142758.1.20884 WP_003142758.1.209 WP_003142758.1.21242 WP_003142758.1.21448 WP_003142758.1.21517 WP_003142758.1.21607 WP_003142758.1.21718 WP_003142758.1.2172 WP_003142758.1.21744 WP_003142758.1.21767 WP_003142758.1.21871 WP_003142758.1.21891 WP_003142758.1.21932 WP_003142758.1.221 WP_003142758.1.2228 WP_003142758.1.22389 WP_003142758.1.22442 WP_003142758.1.22477 WP_003142758.1.22573 WP_003142758.1.22863 WP_003142758.1.2289 WP_003142758.1.22891 WP_003142758.1.23013 WP_003142758.1.23195 WP_003142758.1.2323 WP_003142758.1.23512 WP_003142758.1.23523 WP_003142758.1.23559 WP_003142758.1.23581 WP_003142758.1.23641 WP_003142758.1.23715 WP_003142758.1.23961 WP_003142758.1.24066 WP_003142758.1.24087 WP_003142758.1.24101 WP_003142758.1.24351 WP_003142758.1.2453 WP_003142758.1.24938 WP_003142758.1.25075 WP_003142758.1.251 WP_003142758.1.25142 WP_003142758.1.25149 WP_003142758.1.25179 WP_003142758.1.25348 WP_003142758.1.25532 WP_003142758.1.25695 WP_003142758.1.25964 WP_003142758.1.261 WP_003142758.1.26539 WP_003142758.1.26682 WP_003142758.1.26816 WP_003142758.1.26841 WP_003142758.1.26906 WP_003142758.1.27018 WP_003142758.1.27211 WP_003142758.1.27259 WP_003142758.1.27505 WP_003142758.1.27534 WP_003142758.1.27738 WP_003142758.1.27837 WP_003142758.1.27858 WP_003142758.1.28006 WP_003142758.1.28329 WP_003142758.1.28468 WP_003142758.1.28528 WP_003142758.1.28602 WP_003142758.1.28838 WP_003142758.1.28849 WP_003142758.1.28920 WP_003142758.1.29096 WP_003142758.1.29137 WP_003142758.1.29208 WP_003142758.1.29481 WP_003142758.1.2961 WP_003142758.1.29753 WP_003142758.1.30567 WP_003142758.1.30707 WP_003142758.1.30886 WP_003142758.1.31076 WP_003142758.1.31087 WP_003142758.1.31105 WP_003142758.1.31138 WP_003142758.1.31147 WP_003142758.1.31279 WP_003142758.1.3179 WP_003142758.1.31852 WP_003142758.1.3189 WP_003142758.1.32544 WP_003142758.1.32596 WP_003142758.1.32637 WP_003142758.1.33133 WP_003142758.1.33152 WP_003142758.1.33210 WP_003142758.1.33216 WP_003142758.1.33340 WP_003142758.1.33658 WP_003142758.1.33733 WP_003142758.1.3376 WP_003142758.1.34000 WP_003142758.1.34136 WP_003142758.1.34317 WP_003142758.1.34402 WP_003142758.1.34472 WP_003142758.1.34670 WP_003142758.1.34784 WP_003142758.1.34821 WP_003142758.1.34832 WP_003142758.1.34836 WP_003142758.1.34837 WP_003142758.1.34876 WP_003142758.1.34878 WP_003142758.1.35149 WP_003142758.1.3531 WP_003142758.1.35573 WP_003142758.1.35639 WP_003142758.1.35682 WP_003142758.1.3576 WP_003142758.1.35762 WP_003142758.1.35768 WP_003142758.1.35843 WP_003142758.1.35857 WP_003142758.1.35872 WP_003142758.1.35984 WP_003142758.1.36170 WP_003142758.1.36521 WP_003142758.1.36587 WP_003142758.1.37163 WP_003142758.1.3721 WP_003142758.1.37216 WP_003142758.1.37500 WP_003142758.1.37814 WP_003142758.1.37842 WP_003142758.1.38087 WP_003142758.1.38146 WP_003142758.1.38151 WP_003142758.1.3821 WP_003142758.1.3833 WP_003142758.1.38502 WP_003142758.1.38583 WP_003142758.1.38661 WP_003142758.1.38889 WP_003142758.1.39088 WP_003142758.1.39186 WP_003142758.1.39271 WP_003142758.1.39345 WP_003142758.1.3943 WP_003142758.1.39444 WP_003142758.1.39452 WP_003142758.1.39786 WP_003142758.1.39989 WP_003142758.1.40135 WP_003142758.1.40243 WP_003142758.1.40419 WP_003142758.1.40512 WP_003142758.1.40874 WP_003142758.1.41301 WP_003142758.1.41412 WP_003142758.1.41502 WP_003142758.1.41692 WP_003142758.1.41732 WP_003142758.1.41832 WP_003142758.1.41846 WP_003142758.1.41888 WP_003142758.1.4190 WP_003142758.1.42146 WP_003142758.1.42508 WP_003142758.1.42757 WP_003142758.1.42854 WP_003142758.1.42946 WP_003142758.1.42972 WP_003142758.1.43106 WP_003142758.1.43293 WP_003142758.1.43356 WP_003142758.1.43662 WP_003142758.1.43802 WP_003142758.1.43826 WP_003142758.1.44260 WP_003142758.1.44581 WP_003142758.1.45090 WP_003142758.1.45146 WP_003142758.1.45358 WP_003142758.1.45464 WP_003142758.1.45485 WP_003142758.1.45711 WP_003142758.1.45818 WP_003142758.1.45934 WP_003142758.1.46010 WP_003142758.1.461 WP_003142758.1.46152 WP_003142758.1.46755 WP_003142758.1.46926 WP_003142758.1.4699 WP_003142758.1.47101 WP_003142758.1.47155 WP_003142758.1.4726 WP_003142758.1.47312 WP_003142758.1.47480 WP_003142758.1.47645 WP_003142758.1.47774 WP_003142758.1.47930 WP_003142758.1.47970 WP_003142758.1.48001 WP_003142758.1.48086 WP_003142758.1.4836 WP_003142758.1.48378 WP_003142758.1.48382 WP_003142758.1.48576 WP_003142758.1.48820 WP_003142758.1.48842 WP_003142758.1.49135 WP_003142758.1.49265 WP_003142758.1.49286 WP_003142758.1.49293 WP_003142758.1.49500 WP_003142758.1.49688 WP_003142758.1.49798 WP_003142758.1.49988 WP_003142758.1.49998 WP_003142758.1.50176 WP_003142758.1.5043 WP_003142758.1.50814 WP_003142758.1.50967 WP_003142758.1.51019 WP_003142758.1.51035 WP_003142758.1.51141 WP_003142758.1.51273 WP_003142758.1.51682 WP_003142758.1.51807 WP_003142758.1.52043 WP_003142758.1.52220 WP_003142758.1.5226 WP_003142758.1.52326 WP_003142758.1.5258 WP_003142758.1.52583 WP_003142758.1.52690 WP_003142758.1.52700 WP_003142758.1.52784 WP_003142758.1.53486 WP_003142758.1.53530 WP_003142758.1.53663 WP_003142758.1.53932 WP_003142758.1.54809 WP_003142758.1.55089 WP_003142758.1.55169 WP_003142758.1.55400 WP_003142758.1.56013 WP_003142758.1.56187 WP_003142758.1.56315 WP_003142758.1.56442 WP_003142758.1.56623 WP_003142758.1.56797 WP_003142758.1.56819 WP_003142758.1.56837 WP_003142758.1.56973 WP_003142758.1.57276 WP_003142758.1.57548 WP_003142758.1.58183 WP_003142758.1.58193 WP_003142758.1.58482 WP_003142758.1.58838 WP_003142758.1.58845 WP_003142758.1.5889 WP_003142758.1.59076 WP_003142758.1.59099 WP_003142758.1.60062 WP_003142758.1.60206 WP_003142758.1.60261 WP_003142758.1.60415 WP_003142758.1.60600 WP_003142758.1.60602 WP_003142758.1.60603 WP_003142758.1.60686 WP_003142758.1.60916 WP_003142758.1.61122 WP_003142758.1.61130 WP_003142758.1.61209 WP_003142758.1.6130 WP_003142758.1.61598 WP_003142758.1.61943 WP_003142758.1.62035 WP_003142758.1.62211 WP_003142758.1.62483 WP_003142758.1.62516 WP_003142758.1.62534 WP_003142758.1.62635 WP_003142758.1.62701 WP_003142758.1.62768 WP_003142758.1.62873 WP_003142758.1.62917 WP_003142758.1.63124 WP_003142758.1.63196 WP_003142758.1.63597 WP_003142758.1.63659 WP_003142758.1.64603 WP_003142758.1.64807 WP_003142758.1.64862 WP_003142758.1.64885 WP_003142758.1.64984 WP_003142758.1.65009 WP_003142758.1.65099 WP_003142758.1.65145 WP_003142758.1.65247 WP_003142758.1.65285 WP_003142758.1.65334 WP_003142758.1.65335 WP_003142758.1.65337 WP_003142758.1.65642 WP_003142758.1.65740 WP_003142758.1.65819 WP_003142758.1.65867 WP_003142758.1.65926 WP_003142758.1.6629 WP_003142758.1.66371 WP_003142758.1.66526 WP_003142758.1.66892 WP_003142758.1.66929 WP_003142758.1.66931 WP_003142758.1.66945 WP_003142758.1.66950 WP_003142758.1.67205 WP_003142758.1.67261 WP_003142758.1.67370 WP_003142758.1.67388 WP_003142758.1.67472 WP_003142758.1.67526 WP_003142758.1.67686 WP_003142758.1.67830 WP_003142758.1.68252 WP_003142758.1.6850 WP_003142758.1.68541 WP_003142758.1.68756 WP_003142758.1.68800 WP_003142758.1.68850 WP_003142758.1.68862 WP_003142758.1.68938 WP_003142758.1.69159 WP_003142758.1.69260 WP_003142758.1.69534 WP_003142758.1.69702 WP_003142758.1.69819 WP_003142758.1.69907 WP_003142758.1.69993 WP_003142758.1.70098 WP_003142758.1.70460 WP_003142758.1.70648 WP_003142758.1.7077 WP_003142758.1.70778 WP_003142758.1.71038 WP_003142758.1.7128 WP_003142758.1.71666 WP_003142758.1.71806 WP_003142758.1.72167 WP_003142758.1.72287 WP_003142758.1.72331 WP_003142758.1.72541 WP_003142758.1.7276 WP_003142758.1.72768 WP_003142758.1.73048 WP_003142758.1.7308 WP_003142758.1.73135 WP_003142758.1.73149 WP_003142758.1.73172 WP_003142758.1.7327 WP_003142758.1.73490 WP_003142758.1.73791 WP_003142758.1.7382 WP_003142758.1.73911 WP_003142758.1.74074 WP_003142758.1.74182 WP_003142758.1.74219 WP_003142758.1.74458 WP_003142758.1.74473 WP_003142758.1.7456 WP_003142758.1.748 WP_003142758.1.74958 WP_003142758.1.75119 WP_003142758.1.7547 WP_003142758.1.75549 WP_003142758.1.75573 WP_003142758.1.7595 WP_003142758.1.76092 WP_003142758.1.76322 WP_003142758.1.76355 WP_003142758.1.76383 WP_003142758.1.76399 WP_003142758.1.76600 WP_003142758.1.76716 WP_003142758.1.77235 WP_003142758.1.77238 WP_003142758.1.77317 WP_003142758.1.77490 WP_003142758.1.77566 WP_003142758.1.77769 WP_003142758.1.7779 WP_003142758.1.78134 WP_003142758.1.78280 WP_003142758.1.78430 WP_003142758.1.78437 WP_003142758.1.78570 WP_003142758.1.79256 WP_003142758.1.79311 WP_003142758.1.79364 WP_003142758.1.7953 WP_003142758.1.79569 WP_003142758.1.79631 WP_003142758.1.79788 WP_003142758.1.80087 WP_003142758.1.8028 WP_003142758.1.80410 WP_003142758.1.8064 WP_003142758.1.80846 WP_003142758.1.80880 WP_003142758.1.81081 WP_003142758.1.81581 WP_003142758.1.81816 WP_003142758.1.81844 WP_003142758.1.81950 WP_003142758.1.81957 WP_003142758.1.81960 WP_003142758.1.82312 WP_003142758.1.82334 WP_003142758.1.82710 WP_003142758.1.82882 WP_003142758.1.83184 WP_003142758.1.83251 WP_003142758.1.83296 WP_003142758.1.83394 WP_003142758.1.835 WP_003142758.1.83698 WP_003142758.1.84008 WP_003142758.1.84190 WP_003142758.1.84203 WP_003142758.1.84271 WP_003142758.1.84297 WP_003142758.1.84374 WP_003142758.1.8453 WP_003142758.1.84538 WP_003142758.1.84674 WP_003142758.1.84937 WP_003142758.1.85018 WP_003142758.1.85028 WP_003142758.1.85318 WP_003142758.1.85897 WP_003142758.1.86058 WP_003142758.1.86278 WP_003142758.1.86545 WP_003142758.1.86552 WP_003142758.1.86708 WP_003142758.1.86733 WP_003142758.1.86813 WP_003142758.1.86985 WP_003142758.1.8718 WP_003142758.1.87435 WP_003142758.1.87530 WP_003142758.1.87547 WP_003142758.1.87970 WP_003142758.1.88004 WP_003142758.1.88578 WP_003142758.1.88714 WP_003142758.1.88949 WP_003142758.1.89234 WP_003142758.1.89266 WP_003142758.1.89434 WP_003142758.1.8949 WP_003142758.1.89577 WP_003142758.1.89610 WP_003142758.1.89662 WP_003142758.1.89736 WP_003142758.1.89805 WP_003142758.1.89866 WP_003142758.1.89886 WP_003142758.1.90024 WP_003142758.1.90242 WP_003142758.1.90306 WP_003142758.1.90412 WP_003142758.1.90569 WP_003142758.1.9120 WP_003142758.1.9143 WP_003142758.1.91431 WP_003142758.1.91803 WP_003142758.1.9182 WP_003142758.1.91862 WP_003142758.1.92321 WP_003142758.1.92357 WP_003142758.1.92454 WP_003142758.1.92573 WP_003142758.1.92624 WP_003142758.1.9272 WP_003142758.1.92769 WP_003142758.1.93250 WP_003142758.1.9328 WP_003142758.1.9349 WP_003142758.1.93797 WP_003142758.1.93848 WP_003142758.1.93897 WP_003142758.1.94004 WP_003142758.1.94218 WP_003142758.1.94285 WP_003142758.1.9444 WP_003142758.1.94682 WP_003142758.1.95025 WP_003142758.1.95027 WP_003142758.1.95117 WP_003142758.1.95187 WP_003142758.1.95305 WP_003142758.1.95324 WP_003142758.1.95460 WP_003142758.1.95525 WP_003142758.1.95745 WP_003142758.1.95751 WP_003142758.1.95820 WP_003142758.1.95825 WP_003142758.1.9599 WP_003142758.1.96243 WP_003142758.1.96357 WP_003142758.1.96667 WP_003142758.1.96880 WP_003142758.1.9706 WP_003142758.1.97118 WP_003142758.1.97126 WP_003142758.1.97213 WP_003142758.1.9722 WP_003142758.1.97271 WP_003142758.1.97474 WP_003142758.1.97614 WP_003142758.1.97968 WP_003142758.1.98308 WP_003142758.1.98410 WP_003142758.1.98414 WP_003142758.1.98522 WP_003142758.1.98610 WP_003142758.1.98672 WP_003142758.1.98678 WP_003142758.1.98960 WP_003142758.1.99214 WP_003142758.1.99293 WP_003142758.1.99386 WP_003142758.1.99461 WP_003142758.1.9951 WP_003142758.1.99757 WP_003142758.1.99795 gi|218889287|ref|YP_002438151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]