SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151814|ref|YP_008940761.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568151814|ref|YP_008940761.1|
Domain Number - Region: 47-94
Classification Level Classification E-value
Superfamily FlgN-like 0.0549
Family FlgN-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568151814|ref|YP_008940761.1|
Sequence length 120
Comment hypothetical protein T223_03195 [Pseudomonas aeruginosa LES431]
Sequence
MSRLALLLPAVLLVLLAGALLGGGLVARHYRPQLEEALGQLTASRVASGQLEALLDEQQR
ALAAVRASAERRAKDVEQALGEARAQAAEQYAAAVRLLQEPDIGVDCQAAGAAIDRELGL
Download sequence
Identical sequences A0A072ZFM4 A0A0E1ARL0 A0A0H2ZLE6 A0A157WDL8 A0A1G5J7A5
gi|116054359|ref|YP_788804.1| gi|218889370|ref|YP_002438234.1| WP_003121852.1.100276 WP_003121852.1.100278 WP_003121852.1.100742 WP_003121852.1.101269 WP_003121852.1.101809 WP_003121852.1.101871 WP_003121852.1.10202 WP_003121852.1.10228 WP_003121852.1.10248 WP_003121852.1.1037 WP_003121852.1.10457 WP_003121852.1.10482 WP_003121852.1.10513 WP_003121852.1.10548 WP_003121852.1.10575 WP_003121852.1.10895 WP_003121852.1.11026 WP_003121852.1.11058 WP_003121852.1.1107 WP_003121852.1.1109 WP_003121852.1.11178 WP_003121852.1.11318 WP_003121852.1.11410 WP_003121852.1.11454 WP_003121852.1.11569 WP_003121852.1.11854 WP_003121852.1.1187 WP_003121852.1.11943 WP_003121852.1.12150 WP_003121852.1.12208 WP_003121852.1.12497 WP_003121852.1.12744 WP_003121852.1.12838 WP_003121852.1.12922 WP_003121852.1.12980 WP_003121852.1.13057 WP_003121852.1.13085 WP_003121852.1.13232 WP_003121852.1.13315 WP_003121852.1.13718 WP_003121852.1.13743 WP_003121852.1.13758 WP_003121852.1.14096 WP_003121852.1.14251 WP_003121852.1.14476 WP_003121852.1.14525 WP_003121852.1.14615 WP_003121852.1.14714 WP_003121852.1.1475 WP_003121852.1.14815 WP_003121852.1.14835 WP_003121852.1.14883 WP_003121852.1.15004 WP_003121852.1.15222 WP_003121852.1.15281 WP_003121852.1.15379 WP_003121852.1.15602 WP_003121852.1.15692 WP_003121852.1.15889 WP_003121852.1.15934 WP_003121852.1.16041 WP_003121852.1.16142 WP_003121852.1.162 WP_003121852.1.1646 WP_003121852.1.1670 WP_003121852.1.16751 WP_003121852.1.16801 WP_003121852.1.16808 WP_003121852.1.16811 WP_003121852.1.17108 WP_003121852.1.17162 WP_003121852.1.17177 WP_003121852.1.17223 WP_003121852.1.17353 WP_003121852.1.1739 WP_003121852.1.17697 WP_003121852.1.17890 WP_003121852.1.18052 WP_003121852.1.18117 WP_003121852.1.18156 WP_003121852.1.18157 WP_003121852.1.1824 WP_003121852.1.18440 WP_003121852.1.18508 WP_003121852.1.18892 WP_003121852.1.18907 WP_003121852.1.19089 WP_003121852.1.19199 WP_003121852.1.19260 WP_003121852.1.19351 WP_003121852.1.19640 WP_003121852.1.1971 WP_003121852.1.19711 WP_003121852.1.19718 WP_003121852.1.19803 WP_003121852.1.20024 WP_003121852.1.2012 WP_003121852.1.20134 WP_003121852.1.20692 WP_003121852.1.20825 WP_003121852.1.20880 WP_003121852.1.20890 WP_003121852.1.20978 WP_003121852.1.21096 WP_003121852.1.21517 WP_003121852.1.21767 WP_003121852.1.21801 WP_003121852.1.22365 WP_003121852.1.22389 WP_003121852.1.22704 WP_003121852.1.22863 WP_003121852.1.23166 WP_003121852.1.23195 WP_003121852.1.23394 WP_003121852.1.23523 WP_003121852.1.23559 WP_003121852.1.23611 WP_003121852.1.23715 WP_003121852.1.2374 WP_003121852.1.23782 WP_003121852.1.24101 WP_003121852.1.24351 WP_003121852.1.24382 WP_003121852.1.24413 WP_003121852.1.24447 WP_003121852.1.24626 WP_003121852.1.24662 WP_003121852.1.24869 WP_003121852.1.25052 WP_003121852.1.25075 WP_003121852.1.251 WP_003121852.1.25109 WP_003121852.1.25142 WP_003121852.1.25179 WP_003121852.1.2530 WP_003121852.1.25695 WP_003121852.1.25834 WP_003121852.1.25964 WP_003121852.1.26159 WP_003121852.1.26301 WP_003121852.1.2652 WP_003121852.1.26592 WP_003121852.1.26682 WP_003121852.1.26740 WP_003121852.1.26841 WP_003121852.1.26906 WP_003121852.1.26967 WP_003121852.1.27587 WP_003121852.1.27783 WP_003121852.1.27837 WP_003121852.1.27858 WP_003121852.1.28078 WP_003121852.1.28258 WP_003121852.1.28316 WP_003121852.1.28372 WP_003121852.1.28404 WP_003121852.1.28528 WP_003121852.1.28560 WP_003121852.1.28602 WP_003121852.1.28757 WP_003121852.1.28838 WP_003121852.1.28920 WP_003121852.1.29062 WP_003121852.1.29096 WP_003121852.1.29401 WP_003121852.1.29438 WP_003121852.1.29577 WP_003121852.1.2961 WP_003121852.1.29753 WP_003121852.1.29767 WP_003121852.1.30081 WP_003121852.1.30254 WP_003121852.1.30365 WP_003121852.1.30563 WP_003121852.1.30615 WP_003121852.1.30943 WP_003121852.1.31279 WP_003121852.1.31457 WP_003121852.1.31501 WP_003121852.1.31563 WP_003121852.1.31655 WP_003121852.1.31741 WP_003121852.1.3179 WP_003121852.1.3189 WP_003121852.1.319 WP_003121852.1.32137 WP_003121852.1.32359 WP_003121852.1.32544 WP_003121852.1.32637 WP_003121852.1.32879 WP_003121852.1.33047 WP_003121852.1.33097 WP_003121852.1.33210 WP_003121852.1.33294 WP_003121852.1.33438 WP_003121852.1.33441 WP_003121852.1.3351 WP_003121852.1.33517 WP_003121852.1.33549 WP_003121852.1.33653 WP_003121852.1.33833 WP_003121852.1.34136 WP_003121852.1.34180 WP_003121852.1.34306 WP_003121852.1.34401 WP_003121852.1.34465 WP_003121852.1.34472 WP_003121852.1.34556 WP_003121852.1.34670 WP_003121852.1.34784 WP_003121852.1.34821 WP_003121852.1.34832 WP_003121852.1.34836 WP_003121852.1.34837 WP_003121852.1.35036 WP_003121852.1.35442 WP_003121852.1.35639 WP_003121852.1.35641 WP_003121852.1.35843 WP_003121852.1.35857 WP_003121852.1.35968 WP_003121852.1.36064 WP_003121852.1.36121 WP_003121852.1.36267 WP_003121852.1.36378 WP_003121852.1.36630 WP_003121852.1.37097 WP_003121852.1.37125 WP_003121852.1.37208 WP_003121852.1.37216 WP_003121852.1.373 WP_003121852.1.37500 WP_003121852.1.37571 WP_003121852.1.3768 WP_003121852.1.3792 WP_003121852.1.38023 WP_003121852.1.38060 WP_003121852.1.38087 WP_003121852.1.3821 WP_003121852.1.3833 WP_003121852.1.38337 WP_003121852.1.38502 WP_003121852.1.38587 WP_003121852.1.38816 WP_003121852.1.38971 WP_003121852.1.39088 WP_003121852.1.39452 WP_003121852.1.39989 WP_003121852.1.40135 WP_003121852.1.40207 WP_003121852.1.40419 WP_003121852.1.40442 WP_003121852.1.40546 WP_003121852.1.4058 WP_003121852.1.40984 WP_003121852.1.41110 WP_003121852.1.41412 WP_003121852.1.41429 WP_003121852.1.41748 WP_003121852.1.41846 WP_003121852.1.42047 WP_003121852.1.42259 WP_003121852.1.42316 WP_003121852.1.42499 WP_003121852.1.42643 WP_003121852.1.42778 WP_003121852.1.42789 WP_003121852.1.42870 WP_003121852.1.42946 WP_003121852.1.42972 WP_003121852.1.43024 WP_003121852.1.43106 WP_003121852.1.43286 WP_003121852.1.43662 WP_003121852.1.43756 WP_003121852.1.43998 WP_003121852.1.44046 WP_003121852.1.44486 WP_003121852.1.44725 WP_003121852.1.44739 WP_003121852.1.45090 WP_003121852.1.45485 WP_003121852.1.45604 WP_003121852.1.45700 WP_003121852.1.45818 WP_003121852.1.45934 WP_003121852.1.46010 WP_003121852.1.46152 WP_003121852.1.46306 WP_003121852.1.46436 WP_003121852.1.46633 WP_003121852.1.46787 WP_003121852.1.46885 WP_003121852.1.4699 WP_003121852.1.47155 WP_003121852.1.4726 WP_003121852.1.47296 WP_003121852.1.47469 WP_003121852.1.47527 WP_003121852.1.47645 WP_003121852.1.47774 WP_003121852.1.48024 WP_003121852.1.48178 WP_003121852.1.48334 WP_003121852.1.48472 WP_003121852.1.48576 WP_003121852.1.48851 WP_003121852.1.49108 WP_003121852.1.49135 WP_003121852.1.49266 WP_003121852.1.49806 WP_003121852.1.49842 WP_003121852.1.49976 WP_003121852.1.50691 WP_003121852.1.51035 WP_003121852.1.51141 WP_003121852.1.51273 WP_003121852.1.51457 WP_003121852.1.51585 WP_003121852.1.51682 WP_003121852.1.51727 WP_003121852.1.51957 WP_003121852.1.52043 WP_003121852.1.52326 WP_003121852.1.52500 WP_003121852.1.52690 WP_003121852.1.52697 WP_003121852.1.52850 WP_003121852.1.53351 WP_003121852.1.53951 WP_003121852.1.5399 WP_003121852.1.54293 WP_003121852.1.54497 WP_003121852.1.55318 WP_003121852.1.55387 WP_003121852.1.55543 WP_003121852.1.55813 WP_003121852.1.55976 WP_003121852.1.56452 WP_003121852.1.56475 WP_003121852.1.56623 WP_003121852.1.56626 WP_003121852.1.56797 WP_003121852.1.56837 WP_003121852.1.57020 WP_003121852.1.57369 WP_003121852.1.57566 WP_003121852.1.58056 WP_003121852.1.58200 WP_003121852.1.58360 WP_003121852.1.58436 WP_003121852.1.58482 WP_003121852.1.58510 WP_003121852.1.58527 WP_003121852.1.58800 WP_003121852.1.58838 WP_003121852.1.58845 WP_003121852.1.5889 WP_003121852.1.58944 WP_003121852.1.58952 WP_003121852.1.59076 WP_003121852.1.59099 WP_003121852.1.59158 WP_003121852.1.59376 WP_003121852.1.59797 WP_003121852.1.59831 WP_003121852.1.60062 WP_003121852.1.60079 WP_003121852.1.60084 WP_003121852.1.60085 WP_003121852.1.60206 WP_003121852.1.60261 WP_003121852.1.60364 WP_003121852.1.60415 WP_003121852.1.60472 WP_003121852.1.60603 WP_003121852.1.60639 WP_003121852.1.607 WP_003121852.1.60850 WP_003121852.1.60970 WP_003121852.1.61122 WP_003121852.1.61493 WP_003121852.1.6173 WP_003121852.1.61943 WP_003121852.1.62035 WP_003121852.1.62211 WP_003121852.1.62516 WP_003121852.1.62534 WP_003121852.1.62635 WP_003121852.1.62688 WP_003121852.1.62701 WP_003121852.1.62703 WP_003121852.1.6280 WP_003121852.1.62834 WP_003121852.1.62838 WP_003121852.1.63057 WP_003121852.1.63124 WP_003121852.1.63591 WP_003121852.1.63634 WP_003121852.1.63739 WP_003121852.1.64155 WP_003121852.1.64212 WP_003121852.1.64544 WP_003121852.1.64591 WP_003121852.1.6461 WP_003121852.1.64748 WP_003121852.1.64885 WP_003121852.1.64886 WP_003121852.1.65009 WP_003121852.1.65095 WP_003121852.1.65099 WP_003121852.1.65237 WP_003121852.1.65285 WP_003121852.1.65312 WP_003121852.1.65316 WP_003121852.1.65334 WP_003121852.1.65337 WP_003121852.1.65457 WP_003121852.1.65632 WP_003121852.1.6589 WP_003121852.1.66155 WP_003121852.1.6627 WP_003121852.1.6629 WP_003121852.1.66364 WP_003121852.1.66371 WP_003121852.1.66526 WP_003121852.1.66634 WP_003121852.1.66721 WP_003121852.1.66892 WP_003121852.1.66931 WP_003121852.1.66945 WP_003121852.1.67388 WP_003121852.1.67686 WP_003121852.1.67899 WP_003121852.1.67937 WP_003121852.1.67948 WP_003121852.1.68158 WP_003121852.1.68162 WP_003121852.1.68172 WP_003121852.1.68499 WP_003121852.1.6850 WP_003121852.1.68541 WP_003121852.1.68800 WP_003121852.1.68862 WP_003121852.1.68979 WP_003121852.1.69534 WP_003121852.1.69819 WP_003121852.1.70460 WP_003121852.1.70537 WP_003121852.1.70648 WP_003121852.1.70670 WP_003121852.1.71141 WP_003121852.1.71249 WP_003121852.1.71254 WP_003121852.1.71385 WP_003121852.1.71570 WP_003121852.1.7163 WP_003121852.1.71666 WP_003121852.1.71934 WP_003121852.1.72331 WP_003121852.1.72562 WP_003121852.1.72727 WP_003121852.1.7276 WP_003121852.1.72772 WP_003121852.1.72920 WP_003121852.1.7308 WP_003121852.1.73135 WP_003121852.1.73149 WP_003121852.1.73490 WP_003121852.1.73791 WP_003121852.1.73941 WP_003121852.1.74182 WP_003121852.1.74281 WP_003121852.1.74326 WP_003121852.1.7445 WP_003121852.1.74685 WP_003121852.1.74878 WP_003121852.1.74958 WP_003121852.1.75041 WP_003121852.1.75119 WP_003121852.1.75431 WP_003121852.1.7547 WP_003121852.1.75603 WP_003121852.1.75771 WP_003121852.1.75792 WP_003121852.1.75826 WP_003121852.1.75947 WP_003121852.1.76077 WP_003121852.1.76092 WP_003121852.1.76141 WP_003121852.1.76775 WP_003121852.1.76861 WP_003121852.1.77238 WP_003121852.1.77286 WP_003121852.1.77490 WP_003121852.1.7779 WP_003121852.1.77834 WP_003121852.1.78118 WP_003121852.1.78158 WP_003121852.1.78288 WP_003121852.1.78430 WP_003121852.1.78437 WP_003121852.1.788 WP_003121852.1.78810 WP_003121852.1.79007 WP_003121852.1.79053 WP_003121852.1.79463 WP_003121852.1.79631 WP_003121852.1.79754 WP_003121852.1.799 WP_003121852.1.80087 WP_003121852.1.80102 WP_003121852.1.80174 WP_003121852.1.8038 WP_003121852.1.80645 WP_003121852.1.80683 WP_003121852.1.80785 WP_003121852.1.80846 WP_003121852.1.80910 WP_003121852.1.80931 WP_003121852.1.80938 WP_003121852.1.81081 WP_003121852.1.81082 WP_003121852.1.81426 WP_003121852.1.81470 WP_003121852.1.81487 WP_003121852.1.81581 WP_003121852.1.81708 WP_003121852.1.81816 WP_003121852.1.81856 WP_003121852.1.81874 WP_003121852.1.81927 WP_003121852.1.82127 WP_003121852.1.82310 WP_003121852.1.82312 WP_003121852.1.82643 WP_003121852.1.83131 WP_003121852.1.83213 WP_003121852.1.83374 WP_003121852.1.83440 WP_003121852.1.83460 WP_003121852.1.83503 WP_003121852.1.83540 WP_003121852.1.8357 WP_003121852.1.83637 WP_003121852.1.84174 WP_003121852.1.84177 WP_003121852.1.84203 WP_003121852.1.84271 WP_003121852.1.84374 WP_003121852.1.84538 WP_003121852.1.84558 WP_003121852.1.84589 WP_003121852.1.85018 WP_003121852.1.85150 WP_003121852.1.85303 WP_003121852.1.85638 WP_003121852.1.85788 WP_003121852.1.85910 WP_003121852.1.85920 WP_003121852.1.86058 WP_003121852.1.865 WP_003121852.1.86545 WP_003121852.1.86554 WP_003121852.1.86665 WP_003121852.1.86708 WP_003121852.1.86733 WP_003121852.1.86785 WP_003121852.1.86796 WP_003121852.1.86813 WP_003121852.1.8693 WP_003121852.1.86970 WP_003121852.1.87435 WP_003121852.1.8785 WP_003121852.1.87888 WP_003121852.1.88004 WP_003121852.1.88308 WP_003121852.1.88415 WP_003121852.1.88540 WP_003121852.1.88659 WP_003121852.1.88796 WP_003121852.1.88949 WP_003121852.1.8911 WP_003121852.1.89234 WP_003121852.1.89266 WP_003121852.1.89480 WP_003121852.1.8949 WP_003121852.1.89491 WP_003121852.1.89610 WP_003121852.1.89638 WP_003121852.1.8976 WP_003121852.1.89886 WP_003121852.1.90024 WP_003121852.1.91204 WP_003121852.1.91307 WP_003121852.1.91392 WP_003121852.1.91431 WP_003121852.1.91438 WP_003121852.1.91467 WP_003121852.1.91803 WP_003121852.1.92321 WP_003121852.1.92454 WP_003121852.1.92585 WP_003121852.1.92624 WP_003121852.1.92630 WP_003121852.1.92769 WP_003121852.1.92924 WP_003121852.1.93250 WP_003121852.1.9349 WP_003121852.1.93568 WP_003121852.1.93797 WP_003121852.1.93848 WP_003121852.1.93889 WP_003121852.1.93897 WP_003121852.1.94078 WP_003121852.1.94174 WP_003121852.1.94218 WP_003121852.1.94243 WP_003121852.1.94285 WP_003121852.1.94333 WP_003121852.1.94349 WP_003121852.1.94434 WP_003121852.1.94450 WP_003121852.1.94896 WP_003121852.1.95025 WP_003121852.1.95305 WP_003121852.1.95324 WP_003121852.1.95460 WP_003121852.1.95536 WP_003121852.1.95668 WP_003121852.1.95745 WP_003121852.1.95751 WP_003121852.1.95782 WP_003121852.1.95959 WP_003121852.1.95999 WP_003121852.1.9604 WP_003121852.1.96058 WP_003121852.1.961 WP_003121852.1.96134 WP_003121852.1.96357 WP_003121852.1.96667 WP_003121852.1.96702 WP_003121852.1.96880 WP_003121852.1.9706 WP_003121852.1.9722 WP_003121852.1.97271 WP_003121852.1.98308 WP_003121852.1.9845 WP_003121852.1.985 WP_003121852.1.98522 WP_003121852.1.98672 WP_003121852.1.98814 WP_003121852.1.98873 WP_003121852.1.98960 WP_003121852.1.99065 WP_003121852.1.99214 WP_003121852.1.99378 WP_003121852.1.99386 WP_003121852.1.99443 WP_003121852.1.99461 WP_003121852.1.99647 WP_003121852.1.99757 WP_003121852.1.99772 gi|568151814|ref|YP_008940761.1| gi|564950537|ref|YP_008883107.1| 208963.PA14_08180 557722.PLES_06261 gi|568307386|ref|YP_008979655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]