SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152025|ref|YP_008940972.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152025|ref|YP_008940972.1|
Domain Number 1 Region: 101-225
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.2e-25
Family Aromatic dioxygenase reductase-like 0.002
Further Details:      
 
Domain Number 2 Region: 213-316
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.15e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.015
Further Details:      
 
Domain Number 3 Region: 5-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.27e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568152025|ref|YP_008940972.1|
Sequence length 321
Comment flavodoxin [Pseudomonas aeruginosa LES431]
Sequence
MSASPSSRLHLQVTDFRAVARDVVLVELAAVDGTELPAFTPGAHLELHLGNGLIRHYSLL
NDCRERLRYQLAIGLGDDSRGGARFIHRQLRTGDRLHAAAPRNHFMLREDAARYCFVAGG
IGITPILSMVRWCQAQGKDWRLLYAVRERQRAAFLAELMTLGGERTRLHCSEEGDPLDST
ALIAGLGADEELYCCGPDGLMQAIRDAGSDCAERLHFERFDAPVTPASSSGGTDAFRLEL
RRSALSLRVESHQSILEVLEEQGLEPPYACRAGICRTCETRVCAGEPEHFDHVLSDTERA
SGETLLICVSRCRGNYLELDL
Download sequence
Identical sequences gi|218889626|ref|YP_002438490.1| 557722.PLES_08821 gi|568152025|ref|YP_008940972.1| WP_012613598.1.1037 WP_012613598.1.11026 WP_012613598.1.11943 WP_012613598.1.13232 WP_012613598.1.14714 WP_012613598.1.1475 WP_012613598.1.21517 WP_012613598.1.22863 WP_012613598.1.23195 WP_012613598.1.23715 WP_012613598.1.24351 WP_012613598.1.24869 WP_012613598.1.251 WP_012613598.1.25142 WP_012613598.1.27837 WP_012613598.1.28560 WP_012613598.1.30365 WP_012613598.1.31279 WP_012613598.1.32544 WP_012613598.1.33210 WP_012613598.1.34832 WP_012613598.1.34876 WP_012613598.1.35857 WP_012613598.1.3833 WP_012613598.1.38502 WP_012613598.1.39088 WP_012613598.1.42259 WP_012613598.1.43662 WP_012613598.1.4398 WP_012613598.1.45090 WP_012613598.1.45485 WP_012613598.1.45934 WP_012613598.1.46152 WP_012613598.1.47774 WP_012613598.1.48024 WP_012613598.1.52690 WP_012613598.1.55543 WP_012613598.1.56797 WP_012613598.1.59076 WP_012613598.1.60415 WP_012613598.1.61696 WP_012613598.1.62516 WP_012613598.1.62534 WP_012613598.1.62701 WP_012613598.1.65099 WP_012613598.1.65237 WP_012613598.1.65549 WP_012613598.1.66526 WP_012613598.1.67388 WP_012613598.1.67686 WP_012613598.1.68162 WP_012613598.1.68862 WP_012613598.1.72331 WP_012613598.1.73149 WP_012613598.1.7547 WP_012613598.1.78430 WP_012613598.1.83637 WP_012613598.1.84177 WP_012613598.1.84374 WP_012613598.1.86545 WP_012613598.1.87435 WP_012613598.1.91431 WP_012613598.1.92624 WP_012613598.1.92769 WP_012613598.1.95460 WP_012613598.1.9722 WP_012613598.1.98260 WP_012613598.1.99461 WP_012613598.1.99757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]