SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152154|ref|YP_008941102.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152154|ref|YP_008941102.1|
Domain Number 1 Region: 9-209
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 2.62e-52
Family Cation efflux protein transmembrane domain-like 0.00000155
Further Details:      
 
Domain Number 2 Region: 212-289
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 8.5e-21
Family Cation efflux protein cytoplasmic domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568152154|ref|YP_008941102.1|
Sequence length 298
Comment iron transporter [Pseudomonas aeruginosa LES431]
Sequence
MSPDSPHARLLRLATLASLGVAVTLVIGKAIAWWLSDSVSLLAGLTDSLLDSAASLLNLL
AVHYSLRPADDDHRYGHGKAEALAGLAQAMFIGASAVLVAIQAVEQLRDPQPLGAATWGI
AVMLLSLLLTALLLAFQTHVIRRTGSTAIRADSLHYRSDLLLNASILVALLLARYGWPQS
DGLFGLGIALYILWSALQIARESVSILMDRELPTDISERMRELACSVPGVLGAHDVRTRI
SGNHWFVQLHLELPGELSLSVAHALTDRAVLAIKREYPKAEVLIHADPQEVVGKETVS
Download sequence
Identical sequences gi|568152154|ref|YP_008941102.1| gi|218889754|ref|YP_002438618.1| WP_012613623.1.11026 WP_012613623.1.11943 WP_012613623.1.13232 WP_012613623.1.14714 WP_012613623.1.1475 WP_012613623.1.21517 WP_012613623.1.22863 WP_012613623.1.23195 WP_012613623.1.23512 WP_012613623.1.23715 WP_012613623.1.24351 WP_012613623.1.251 WP_012613623.1.25142 WP_012613623.1.27837 WP_012613623.1.31279 WP_012613623.1.32544 WP_012613623.1.33210 WP_012613623.1.34832 WP_012613623.1.35857 WP_012613623.1.3833 WP_012613623.1.38502 WP_012613623.1.39088 WP_012613623.1.43662 WP_012613623.1.45090 WP_012613623.1.45485 WP_012613623.1.45934 WP_012613623.1.46152 WP_012613623.1.47774 WP_012613623.1.52690 WP_012613623.1.56797 WP_012613623.1.59076 WP_012613623.1.60415 WP_012613623.1.60603 WP_012613623.1.61696 WP_012613623.1.62516 WP_012613623.1.62534 WP_012613623.1.62701 WP_012613623.1.65099 WP_012613623.1.66526 WP_012613623.1.67388 WP_012613623.1.67686 WP_012613623.1.68862 WP_012613623.1.72331 WP_012613623.1.73149 WP_012613623.1.7547 WP_012613623.1.77769 WP_012613623.1.78430 WP_012613623.1.84374 WP_012613623.1.86545 WP_012613623.1.87435 WP_012613623.1.91431 WP_012613623.1.92624 WP_012613623.1.92769 WP_012613623.1.95460 WP_012613623.1.9722 WP_012613623.1.99461 WP_012613623.1.99757 557722.PLES_10121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]