SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152260|ref|YP_008941208.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152260|ref|YP_008941208.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000499
Family Glutathione S-transferase (GST), N-terminal domain 0.032
Further Details:      
 
Domain Number 2 Region: 158-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000655
Family Glutathione S-transferase (GST), C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568152260|ref|YP_008941208.1|
Sequence length 233
Comment hypothetical protein T223_05495 [Pseudomonas aeruginosa LES431]
Sequence
MITLFQFPAAFNVPNASPYCLKLETWLRLAGLEYQVKVVSDPRKAPKGKLPYVRIEGEAI
GDSEIVIRTLGERYGVTLDAGLDARGKGWARAITRLCDEHLYYLMLYFRWFDEDSWRVLK
PVFFGSLPFGVRDAVAWAMRRKVRATLRAQGLGVHGRDELLAFARDDLDALDGLLGQVPY
YGGEHPCSADAAAYGILANLIEATLDTPLSHVARGYPRLVAYCERMRERVWSE
Download sequence
Identical sequences A0A072ZD98 A0A0E1ANE9 A0A0H2ZFB8 A0A0H3R4Q9 A0A157WQM0 A0A1C7BWE8 A0A1E9CGX1 A0A1F0IF22 A0A1S1BUH5 Q9HXF1 V6AAF9
gi|568307881|ref|YP_008980150.1| gi|392982416|ref|YP_006481003.1| gi|386057150|ref|YP_005973672.1| gi|386067947|ref|YP_005983251.1| gi|514411049|ref|YP_008134484.1| NP_252544.1.87394 WP_003092922.1.100071 WP_003092922.1.100100 WP_003092922.1.100179 WP_003092922.1.100276 WP_003092922.1.100278 WP_003092922.1.100319 WP_003092922.1.100394 WP_003092922.1.100420 WP_003092922.1.100456 WP_003092922.1.100469 WP_003092922.1.100473 WP_003092922.1.100476 WP_003092922.1.100523 WP_003092922.1.100654 WP_003092922.1.100723 WP_003092922.1.100742 WP_003092922.1.100777 WP_003092922.1.100786 WP_003092922.1.100808 WP_003092922.1.100809 WP_003092922.1.100810 WP_003092922.1.100872 WP_003092922.1.100983 WP_003092922.1.100995 WP_003092922.1.101021 WP_003092922.1.101047 WP_003092922.1.101090 WP_003092922.1.101269 WP_003092922.1.101310 WP_003092922.1.101340 WP_003092922.1.101506 WP_003092922.1.101572 WP_003092922.1.101590 WP_003092922.1.101642 WP_003092922.1.101712 WP_003092922.1.10174 WP_003092922.1.101781 WP_003092922.1.10179 WP_003092922.1.101809 WP_003092922.1.101819 WP_003092922.1.10185 WP_003092922.1.101863 WP_003092922.1.101871 WP_003092922.1.10201 WP_003092922.1.10202 WP_003092922.1.102045 WP_003092922.1.10228 WP_003092922.1.10248 WP_003092922.1.10257 WP_003092922.1.10271 WP_003092922.1.1037 WP_003092922.1.10407 WP_003092922.1.10419 WP_003092922.1.10435 WP_003092922.1.10457 WP_003092922.1.10468 WP_003092922.1.10477 WP_003092922.1.10482 WP_003092922.1.10513 WP_003092922.1.10529 WP_003092922.1.10572 WP_003092922.1.10575 WP_003092922.1.10636 WP_003092922.1.10641 WP_003092922.1.10684 WP_003092922.1.10764 WP_003092922.1.10856 WP_003092922.1.10895 WP_003092922.1.10901 WP_003092922.1.10949 WP_003092922.1.11026 WP_003092922.1.11058 WP_003092922.1.1107 WP_003092922.1.11077 WP_003092922.1.1109 WP_003092922.1.11130 WP_003092922.1.11163 WP_003092922.1.11178 WP_003092922.1.11180 WP_003092922.1.11318 WP_003092922.1.11381 WP_003092922.1.11388 WP_003092922.1.11410 WP_003092922.1.11417 WP_003092922.1.11454 WP_003092922.1.11568 WP_003092922.1.11569 WP_003092922.1.11653 WP_003092922.1.11744 WP_003092922.1.1180 WP_003092922.1.1183 WP_003092922.1.11847 WP_003092922.1.11854 WP_003092922.1.1187 WP_003092922.1.11943 WP_003092922.1.12018 WP_003092922.1.12081 WP_003092922.1.12120 WP_003092922.1.12150 WP_003092922.1.12200 WP_003092922.1.12208 WP_003092922.1.12240 WP_003092922.1.12302 WP_003092922.1.12400 WP_003092922.1.12482 WP_003092922.1.12497 WP_003092922.1.12530 WP_003092922.1.12547 WP_003092922.1.12561 WP_003092922.1.12657 WP_003092922.1.12660 WP_003092922.1.12670 WP_003092922.1.12687 WP_003092922.1.12797 WP_003092922.1.12838 WP_003092922.1.12873 WP_003092922.1.12890 WP_003092922.1.12891 WP_003092922.1.12922 WP_003092922.1.12934 WP_003092922.1.12970 WP_003092922.1.12980 WP_003092922.1.13 WP_003092922.1.13041 WP_003092922.1.1305 WP_003092922.1.13057 WP_003092922.1.13077 WP_003092922.1.13085 WP_003092922.1.13092 WP_003092922.1.13208 WP_003092922.1.13232 WP_003092922.1.13242 WP_003092922.1.13270 WP_003092922.1.13315 WP_003092922.1.1333 WP_003092922.1.13364 WP_003092922.1.13407 WP_003092922.1.13529 WP_003092922.1.13533 WP_003092922.1.1356 WP_003092922.1.1362 WP_003092922.1.13622 WP_003092922.1.13642 WP_003092922.1.13718 WP_003092922.1.13743 WP_003092922.1.13758 WP_003092922.1.13765 WP_003092922.1.13785 WP_003092922.1.13795 WP_003092922.1.13828 WP_003092922.1.13865 WP_003092922.1.1393 WP_003092922.1.14049 WP_003092922.1.14078 WP_003092922.1.14096 WP_003092922.1.14116 WP_003092922.1.14204 WP_003092922.1.14251 WP_003092922.1.14378 WP_003092922.1.14424 WP_003092922.1.14455 WP_003092922.1.14460 WP_003092922.1.14463 WP_003092922.1.14525 WP_003092922.1.14564 WP_003092922.1.14640 WP_003092922.1.14679 WP_003092922.1.14690 WP_003092922.1.14714 WP_003092922.1.1475 WP_003092922.1.14754 WP_003092922.1.14815 WP_003092922.1.14820 WP_003092922.1.14835 WP_003092922.1.14839 WP_003092922.1.14966 WP_003092922.1.14981 WP_003092922.1.15004 WP_003092922.1.15130 WP_003092922.1.1516 WP_003092922.1.152 WP_003092922.1.15222 WP_003092922.1.15231 WP_003092922.1.15281 WP_003092922.1.15297 WP_003092922.1.15328 WP_003092922.1.15373 WP_003092922.1.15379 WP_003092922.1.15408 WP_003092922.1.15474 WP_003092922.1.15480 WP_003092922.1.15482 WP_003092922.1.15485 WP_003092922.1.15602 WP_003092922.1.15666 WP_003092922.1.15692 WP_003092922.1.15886 WP_003092922.1.15889 WP_003092922.1.15934 WP_003092922.1.16041 WP_003092922.1.16074 WP_003092922.1.16109 WP_003092922.1.16142 WP_003092922.1.16161 WP_003092922.1.16197 WP_003092922.1.16239 WP_003092922.1.16242 WP_003092922.1.16267 WP_003092922.1.16279 WP_003092922.1.16419 WP_003092922.1.16660 WP_003092922.1.16694 WP_003092922.1.1670 WP_003092922.1.1671 WP_003092922.1.16751 WP_003092922.1.16782 WP_003092922.1.16788 WP_003092922.1.16801 WP_003092922.1.16808 WP_003092922.1.16811 WP_003092922.1.16895 WP_003092922.1.17022 WP_003092922.1.1704 WP_003092922.1.17108 WP_003092922.1.17155 WP_003092922.1.17162 WP_003092922.1.17177 WP_003092922.1.17189 WP_003092922.1.172 WP_003092922.1.17223 WP_003092922.1.17354 WP_003092922.1.17370 WP_003092922.1.1739 WP_003092922.1.17397 WP_003092922.1.17499 WP_003092922.1.17566 WP_003092922.1.1761 WP_003092922.1.17697 WP_003092922.1.17883 WP_003092922.1.17890 WP_003092922.1.18052 WP_003092922.1.18156 WP_003092922.1.18157 WP_003092922.1.18199 WP_003092922.1.18204 WP_003092922.1.18234 WP_003092922.1.1824 WP_003092922.1.18349 WP_003092922.1.18440 WP_003092922.1.18493 WP_003092922.1.18508 WP_003092922.1.18547 WP_003092922.1.18653 WP_003092922.1.18728 WP_003092922.1.18732 WP_003092922.1.18735 WP_003092922.1.18769 WP_003092922.1.18795 WP_003092922.1.18852 WP_003092922.1.18892 WP_003092922.1.18907 WP_003092922.1.18911 WP_003092922.1.18930 WP_003092922.1.190 WP_003092922.1.19089 WP_003092922.1.19199 WP_003092922.1.19251 WP_003092922.1.19269 WP_003092922.1.19346 WP_003092922.1.19351 WP_003092922.1.19376 WP_003092922.1.1938 WP_003092922.1.19552 WP_003092922.1.19591 WP_003092922.1.19640 WP_003092922.1.19703 WP_003092922.1.1971 WP_003092922.1.19711 WP_003092922.1.19718 WP_003092922.1.19741 WP_003092922.1.19771 WP_003092922.1.19930 WP_003092922.1.19931 WP_003092922.1.20024 WP_003092922.1.20070 WP_003092922.1.2012 WP_003092922.1.20125 WP_003092922.1.20134 WP_003092922.1.20216 WP_003092922.1.20342 WP_003092922.1.20590 WP_003092922.1.20682 WP_003092922.1.20692 WP_003092922.1.20744 WP_003092922.1.20764 WP_003092922.1.20825 WP_003092922.1.20854 WP_003092922.1.20880 WP_003092922.1.20884 WP_003092922.1.20890 WP_003092922.1.209 WP_003092922.1.20929 WP_003092922.1.21002 WP_003092922.1.21096 WP_003092922.1.21100 WP_003092922.1.21166 WP_003092922.1.21209 WP_003092922.1.21242 WP_003092922.1.21253 WP_003092922.1.21302 WP_003092922.1.21349 WP_003092922.1.21358 WP_003092922.1.2144 WP_003092922.1.21448 WP_003092922.1.21460 WP_003092922.1.21469 WP_003092922.1.21471 WP_003092922.1.21517 WP_003092922.1.21607 WP_003092922.1.21718 WP_003092922.1.2172 WP_003092922.1.21744 WP_003092922.1.21767 WP_003092922.1.21782 WP_003092922.1.21801 WP_003092922.1.21863 WP_003092922.1.21871 WP_003092922.1.21891 WP_003092922.1.21932 WP_003092922.1.22078 WP_003092922.1.221 WP_003092922.1.2228 WP_003092922.1.22324 WP_003092922.1.2237 WP_003092922.1.22389 WP_003092922.1.22394 WP_003092922.1.22442 WP_003092922.1.22477 WP_003092922.1.22491 WP_003092922.1.22573 WP_003092922.1.22671 WP_003092922.1.22704 WP_003092922.1.22729 WP_003092922.1.22863 WP_003092922.1.2289 WP_003092922.1.22891 WP_003092922.1.23013 WP_003092922.1.23191 WP_003092922.1.23195 WP_003092922.1.2323 WP_003092922.1.23264 WP_003092922.1.23331 WP_003092922.1.23394 WP_003092922.1.23418 WP_003092922.1.23421 WP_003092922.1.23512 WP_003092922.1.23518 WP_003092922.1.23523 WP_003092922.1.23525 WP_003092922.1.2355 WP_003092922.1.23559 WP_003092922.1.23581 WP_003092922.1.236 WP_003092922.1.23611 WP_003092922.1.23641 WP_003092922.1.23715 WP_003092922.1.23739 WP_003092922.1.2374 WP_003092922.1.23769 WP_003092922.1.23884 WP_003092922.1.23925 WP_003092922.1.23938 WP_003092922.1.23961 WP_003092922.1.23967 WP_003092922.1.23983 WP_003092922.1.24066 WP_003092922.1.24077 WP_003092922.1.24087 WP_003092922.1.24101 WP_003092922.1.24183 WP_003092922.1.24234 WP_003092922.1.24319 WP_003092922.1.24351 WP_003092922.1.24382 WP_003092922.1.24413 WP_003092922.1.24447 WP_003092922.1.2453 WP_003092922.1.24626 WP_003092922.1.24662 WP_003092922.1.2477 WP_003092922.1.24851 WP_003092922.1.24862 WP_003092922.1.24869 WP_003092922.1.24879 WP_003092922.1.24938 WP_003092922.1.25033 WP_003092922.1.25052 WP_003092922.1.25067 WP_003092922.1.25075 WP_003092922.1.251 WP_003092922.1.25109 WP_003092922.1.2511 WP_003092922.1.25142 WP_003092922.1.25149 WP_003092922.1.25179 WP_003092922.1.25191 WP_003092922.1.25271 WP_003092922.1.2529 WP_003092922.1.2530 WP_003092922.1.25328 WP_003092922.1.25344 WP_003092922.1.25348 WP_003092922.1.2535 WP_003092922.1.25477 WP_003092922.1.25532 WP_003092922.1.25600 WP_003092922.1.25641 WP_003092922.1.25695 WP_003092922.1.2572 WP_003092922.1.25903 WP_003092922.1.2596 WP_003092922.1.25964 WP_003092922.1.26025 WP_003092922.1.26042 WP_003092922.1.261 WP_003092922.1.26159 WP_003092922.1.26301 WP_003092922.1.26334 WP_003092922.1.26428 WP_003092922.1.26463 WP_003092922.1.26473 WP_003092922.1.26489 WP_003092922.1.2652 WP_003092922.1.26539 WP_003092922.1.26553 WP_003092922.1.26592 WP_003092922.1.26604 WP_003092922.1.26681 WP_003092922.1.26705 WP_003092922.1.26816 WP_003092922.1.26841 WP_003092922.1.26862 WP_003092922.1.26906 WP_003092922.1.26967 WP_003092922.1.2698 WP_003092922.1.27018 WP_003092922.1.27028 WP_003092922.1.27073 WP_003092922.1.27107 WP_003092922.1.27211 WP_003092922.1.27218 WP_003092922.1.27259 WP_003092922.1.27288 WP_003092922.1.27505 WP_003092922.1.27534 WP_003092922.1.27549 WP_003092922.1.27575 WP_003092922.1.27587 WP_003092922.1.27687 WP_003092922.1.27738 WP_003092922.1.27783 WP_003092922.1.27837 WP_003092922.1.27858 WP_003092922.1.27933 WP_003092922.1.27939 WP_003092922.1.27966 WP_003092922.1.28006 WP_003092922.1.28057 WP_003092922.1.28064 WP_003092922.1.28136 WP_003092922.1.28175 WP_003092922.1.28193 WP_003092922.1.28258 WP_003092922.1.283 WP_003092922.1.28316 WP_003092922.1.28329 WP_003092922.1.28372 WP_003092922.1.28382 WP_003092922.1.28383 WP_003092922.1.28404 WP_003092922.1.28468 WP_003092922.1.28528 WP_003092922.1.28560 WP_003092922.1.28602 WP_003092922.1.28623 WP_003092922.1.28699 WP_003092922.1.28713 WP_003092922.1.28757 WP_003092922.1.28800 WP_003092922.1.28823 WP_003092922.1.28838 WP_003092922.1.28849 WP_003092922.1.28878 WP_003092922.1.28920 WP_003092922.1.29003 WP_003092922.1.29008 WP_003092922.1.29062 WP_003092922.1.29070 WP_003092922.1.29096 WP_003092922.1.29127 WP_003092922.1.29137 WP_003092922.1.29158 WP_003092922.1.29179 WP_003092922.1.29208 WP_003092922.1.2927 WP_003092922.1.29401 WP_003092922.1.2941 WP_003092922.1.29438 WP_003092922.1.29472 WP_003092922.1.2948 WP_003092922.1.29481 WP_003092922.1.29498 WP_003092922.1.29501 WP_003092922.1.29577 WP_003092922.1.2961 WP_003092922.1.29650 WP_003092922.1.29668 WP_003092922.1.29753 WP_003092922.1.2980 WP_003092922.1.29848 WP_003092922.1.29920 WP_003092922.1.29958 WP_003092922.1.30000 WP_003092922.1.30020 WP_003092922.1.30081 WP_003092922.1.30120 WP_003092922.1.30254 WP_003092922.1.3030 WP_003092922.1.30365 WP_003092922.1.30474 WP_003092922.1.30475 WP_003092922.1.30563 WP_003092922.1.30567 WP_003092922.1.30614 WP_003092922.1.30615 WP_003092922.1.30625 WP_003092922.1.30693 WP_003092922.1.30707 WP_003092922.1.3072 WP_003092922.1.30740 WP_003092922.1.30797 WP_003092922.1.30815 WP_003092922.1.30842 WP_003092922.1.30886 WP_003092922.1.30943 WP_003092922.1.30973 WP_003092922.1.30994 WP_003092922.1.31045 WP_003092922.1.31076 WP_003092922.1.31087 WP_003092922.1.31105 WP_003092922.1.31138 WP_003092922.1.31147 WP_003092922.1.31279 WP_003092922.1.31361 WP_003092922.1.31457 WP_003092922.1.31501 WP_003092922.1.31563 WP_003092922.1.31565 WP_003092922.1.31587 WP_003092922.1.31633 WP_003092922.1.31655 WP_003092922.1.3172 WP_003092922.1.31741 WP_003092922.1.31751 WP_003092922.1.3179 WP_003092922.1.31848 WP_003092922.1.31852 WP_003092922.1.3189 WP_003092922.1.31939 WP_003092922.1.32137 WP_003092922.1.32144 WP_003092922.1.32235 WP_003092922.1.32289 WP_003092922.1.32314 WP_003092922.1.32359 WP_003092922.1.32447 WP_003092922.1.32523 WP_003092922.1.32544 WP_003092922.1.32596 WP_003092922.1.32626 WP_003092922.1.32637 WP_003092922.1.32641 WP_003092922.1.32711 WP_003092922.1.32869 WP_003092922.1.32879 WP_003092922.1.32998 WP_003092922.1.33009 WP_003092922.1.33047 WP_003092922.1.33133 WP_003092922.1.33152 WP_003092922.1.33186 WP_003092922.1.33204 WP_003092922.1.33210 WP_003092922.1.33216 WP_003092922.1.33294 WP_003092922.1.33340 WP_003092922.1.33387 WP_003092922.1.33438 WP_003092922.1.33441 WP_003092922.1.33455 WP_003092922.1.3351 WP_003092922.1.33517 WP_003092922.1.33521 WP_003092922.1.33523 WP_003092922.1.33547 WP_003092922.1.33549 WP_003092922.1.33653 WP_003092922.1.33658 WP_003092922.1.33669 WP_003092922.1.3368 WP_003092922.1.33728 WP_003092922.1.33733 WP_003092922.1.33734 WP_003092922.1.33774 WP_003092922.1.33801 WP_003092922.1.33814 WP_003092922.1.33822 WP_003092922.1.33833 WP_003092922.1.33945 WP_003092922.1.34000 WP_003092922.1.34039 WP_003092922.1.34136 WP_003092922.1.34150 WP_003092922.1.34151 WP_003092922.1.34191 WP_003092922.1.34306 WP_003092922.1.34317 WP_003092922.1.34324 WP_003092922.1.3436 WP_003092922.1.34401 WP_003092922.1.34402 WP_003092922.1.34461 WP_003092922.1.34465 WP_003092922.1.34472 WP_003092922.1.3452 WP_003092922.1.34556 WP_003092922.1.34568 WP_003092922.1.34625 WP_003092922.1.34670 WP_003092922.1.34689 WP_003092922.1.34784 WP_003092922.1.34821 WP_003092922.1.34832 WP_003092922.1.34836 WP_003092922.1.34837 WP_003092922.1.34876 WP_003092922.1.34878 WP_003092922.1.34901 WP_003092922.1.34922 WP_003092922.1.34942 WP_003092922.1.35036 WP_003092922.1.35104 WP_003092922.1.35149 WP_003092922.1.35231 WP_003092922.1.35281 WP_003092922.1.3531 WP_003092922.1.35325 WP_003092922.1.35353 WP_003092922.1.3540 WP_003092922.1.35431 WP_003092922.1.35442 WP_003092922.1.35480 WP_003092922.1.35512 WP_003092922.1.35529 WP_003092922.1.3555 WP_003092922.1.35573 WP_003092922.1.35599 WP_003092922.1.35639 WP_003092922.1.35641 WP_003092922.1.35669 WP_003092922.1.35679 WP_003092922.1.3568 WP_003092922.1.35682 WP_003092922.1.3576 WP_003092922.1.35762 WP_003092922.1.35768 WP_003092922.1.35822 WP_003092922.1.35843 WP_003092922.1.35857 WP_003092922.1.35872 WP_003092922.1.35968 WP_003092922.1.35984 WP_003092922.1.36064 WP_003092922.1.36148 WP_003092922.1.36170 WP_003092922.1.36266 WP_003092922.1.36267 WP_003092922.1.36285 WP_003092922.1.36378 WP_003092922.1.36435 WP_003092922.1.36487 WP_003092922.1.36521 WP_003092922.1.3653 WP_003092922.1.36587 WP_003092922.1.36608 WP_003092922.1.3662 WP_003092922.1.36630 WP_003092922.1.36665 WP_003092922.1.36708 WP_003092922.1.3672 WP_003092922.1.36756 WP_003092922.1.36781 WP_003092922.1.36879 WP_003092922.1.37050 WP_003092922.1.37097 WP_003092922.1.37125 WP_003092922.1.37163 WP_003092922.1.37208 WP_003092922.1.3721 WP_003092922.1.37216 WP_003092922.1.373 WP_003092922.1.37319 WP_003092922.1.37366 WP_003092922.1.3742 WP_003092922.1.37500 WP_003092922.1.37512 WP_003092922.1.37571 WP_003092922.1.3773 WP_003092922.1.37799 WP_003092922.1.3781 WP_003092922.1.37814 WP_003092922.1.37818 WP_003092922.1.37826 WP_003092922.1.37842 WP_003092922.1.3785 WP_003092922.1.3792 WP_003092922.1.38003 WP_003092922.1.38023 WP_003092922.1.38087 WP_003092922.1.38102 WP_003092922.1.38146 WP_003092922.1.38151 WP_003092922.1.3818 WP_003092922.1.38186 WP_003092922.1.3821 WP_003092922.1.38319 WP_003092922.1.3833 WP_003092922.1.38335 WP_003092922.1.38337 WP_003092922.1.38406 WP_003092922.1.38430 WP_003092922.1.38502 WP_003092922.1.38505 WP_003092922.1.38510 WP_003092922.1.38582 WP_003092922.1.38583 WP_003092922.1.38587 WP_003092922.1.38657 WP_003092922.1.38661 WP_003092922.1.3870 WP_003092922.1.38706 WP_003092922.1.38727 WP_003092922.1.38816 WP_003092922.1.38834 WP_003092922.1.38889 WP_003092922.1.38971 WP_003092922.1.39046 WP_003092922.1.39088 WP_003092922.1.39122 WP_003092922.1.39186 WP_003092922.1.39271 WP_003092922.1.39326 WP_003092922.1.39345 WP_003092922.1.3943 WP_003092922.1.39444 WP_003092922.1.39452 WP_003092922.1.39458 WP_003092922.1.39765 WP_003092922.1.39786 WP_003092922.1.39811 WP_003092922.1.39920 WP_003092922.1.39949 WP_003092922.1.3998 WP_003092922.1.39989 WP_003092922.1.40059 WP_003092922.1.40115 WP_003092922.1.40135 WP_003092922.1.40207 WP_003092922.1.40213 WP_003092922.1.40243 WP_003092922.1.40271 WP_003092922.1.4038 WP_003092922.1.40419 WP_003092922.1.40442 WP_003092922.1.40512 WP_003092922.1.40513 WP_003092922.1.40541 WP_003092922.1.40546 WP_003092922.1.40595 WP_003092922.1.40703 WP_003092922.1.40874 WP_003092922.1.40950 WP_003092922.1.40984 WP_003092922.1.40993 WP_003092922.1.40994 WP_003092922.1.41110 WP_003092922.1.41137 WP_003092922.1.41199 WP_003092922.1.41290 WP_003092922.1.41291 WP_003092922.1.41301 WP_003092922.1.41384 WP_003092922.1.41412 WP_003092922.1.41429 WP_003092922.1.41487 WP_003092922.1.41492 WP_003092922.1.41502 WP_003092922.1.41618 WP_003092922.1.41624 WP_003092922.1.41625 WP_003092922.1.41692 WP_003092922.1.41703 WP_003092922.1.41732 WP_003092922.1.41748 WP_003092922.1.41773 WP_003092922.1.41832 WP_003092922.1.41846 WP_003092922.1.41871 WP_003092922.1.41888 WP_003092922.1.4190 WP_003092922.1.41939 WP_003092922.1.4196 WP_003092922.1.42 WP_003092922.1.42019 WP_003092922.1.42041 WP_003092922.1.42146 WP_003092922.1.42259 WP_003092922.1.42294 WP_003092922.1.42316 WP_003092922.1.42381 WP_003092922.1.42411 WP_003092922.1.42423 WP_003092922.1.42463 WP_003092922.1.42499 WP_003092922.1.42508 WP_003092922.1.42634 WP_003092922.1.42643 WP_003092922.1.42690 WP_003092922.1.42696 WP_003092922.1.42723 WP_003092922.1.4273 WP_003092922.1.42754 WP_003092922.1.42757 WP_003092922.1.42778 WP_003092922.1.42789 WP_003092922.1.42854 WP_003092922.1.42856 WP_003092922.1.42870 WP_003092922.1.42917 WP_003092922.1.42946 WP_003092922.1.42952 WP_003092922.1.42972 WP_003092922.1.42973 WP_003092922.1.43022 WP_003092922.1.43024 WP_003092922.1.43026 WP_003092922.1.43049 WP_003092922.1.43106 WP_003092922.1.43107 WP_003092922.1.43212 WP_003092922.1.43245 WP_003092922.1.43286 WP_003092922.1.43293 WP_003092922.1.43326 WP_003092922.1.43330 WP_003092922.1.43356 WP_003092922.1.4348 WP_003092922.1.43593 WP_003092922.1.43603 WP_003092922.1.43662 WP_003092922.1.43667 WP_003092922.1.43673 WP_003092922.1.43696 WP_003092922.1.43729 WP_003092922.1.43756 WP_003092922.1.43783 WP_003092922.1.43802 WP_003092922.1.4381 WP_003092922.1.43811 WP_003092922.1.43826 WP_003092922.1.4397 WP_003092922.1.4398 WP_003092922.1.43998 WP_003092922.1.44046 WP_003092922.1.44094 WP_003092922.1.44213 WP_003092922.1.44260 WP_003092922.1.44269 WP_003092922.1.44434 WP_003092922.1.44486 WP_003092922.1.44552 WP_003092922.1.44563 WP_003092922.1.44581 WP_003092922.1.44725 WP_003092922.1.44739 WP_003092922.1.44760 WP_003092922.1.44804 WP_003092922.1.44870 WP_003092922.1.4493 WP_003092922.1.44959 WP_003092922.1.45063 WP_003092922.1.45090 WP_003092922.1.45146 WP_003092922.1.45199 WP_003092922.1.45202 WP_003092922.1.4522 WP_003092922.1.45228 WP_003092922.1.45298 WP_003092922.1.45306 WP_003092922.1.45312 WP_003092922.1.4532 WP_003092922.1.45328 WP_003092922.1.45353 WP_003092922.1.45358 WP_003092922.1.45464 WP_003092922.1.45478 WP_003092922.1.45485 WP_003092922.1.45611 WP_003092922.1.45635 WP_003092922.1.45636 WP_003092922.1.45678 WP_003092922.1.45700 WP_003092922.1.45711 WP_003092922.1.45723 WP_003092922.1.45818 WP_003092922.1.45837 WP_003092922.1.45920 WP_003092922.1.45934 WP_003092922.1.45946 WP_003092922.1.45961 WP_003092922.1.46010 WP_003092922.1.46032 WP_003092922.1.46093 WP_003092922.1.461 WP_003092922.1.46152 WP_003092922.1.46200 WP_003092922.1.46306 WP_003092922.1.4640 WP_003092922.1.46436 WP_003092922.1.46502 WP_003092922.1.46623 WP_003092922.1.46755 WP_003092922.1.46787 WP_003092922.1.46826 WP_003092922.1.46846 WP_003092922.1.46866 WP_003092922.1.46885 WP_003092922.1.46926 WP_003092922.1.4699 WP_003092922.1.47101 WP_003092922.1.47150 WP_003092922.1.47155 WP_003092922.1.47158 WP_003092922.1.47251 WP_003092922.1.4726 WP_003092922.1.47296 WP_003092922.1.47312 WP_003092922.1.47314 WP_003092922.1.47469 WP_003092922.1.47480 WP_003092922.1.47527 WP_003092922.1.47551 WP_003092922.1.47598 WP_003092922.1.47645 WP_003092922.1.47774 WP_003092922.1.47930 WP_003092922.1.47934 WP_003092922.1.47970 WP_003092922.1.48001 WP_003092922.1.48024 WP_003092922.1.48086 WP_003092922.1.48094 WP_003092922.1.48141 WP_003092922.1.48172 WP_003092922.1.48321 WP_003092922.1.48334 WP_003092922.1.4836 WP_003092922.1.48378 WP_003092922.1.48382 WP_003092922.1.48413 WP_003092922.1.48472 WP_003092922.1.48474 WP_003092922.1.48487 WP_003092922.1.48545 WP_003092922.1.48546 WP_003092922.1.48576 WP_003092922.1.48579 WP_003092922.1.48747 WP_003092922.1.48820 WP_003092922.1.48840 WP_003092922.1.48842 WP_003092922.1.48851 WP_003092922.1.48870 WP_003092922.1.48961 WP_003092922.1.49108 WP_003092922.1.49135 WP_003092922.1.49244 WP_003092922.1.49265 WP_003092922.1.49277 WP_003092922.1.49286 WP_003092922.1.49293 WP_003092922.1.49360 WP_003092922.1.49416 WP_003092922.1.49500 WP_003092922.1.49566 WP_003092922.1.49688 WP_003092922.1.49798 WP_003092922.1.49806 WP_003092922.1.49833 WP_003092922.1.49842 WP_003092922.1.49922 WP_003092922.1.49948 WP_003092922.1.49976 WP_003092922.1.49988 WP_003092922.1.49998 WP_003092922.1.50176 WP_003092922.1.50180 WP_003092922.1.50222 WP_003092922.1.50232 WP_003092922.1.50242 WP_003092922.1.5043 WP_003092922.1.50450 WP_003092922.1.50459 WP_003092922.1.50567 WP_003092922.1.50653 WP_003092922.1.50668 WP_003092922.1.50682 WP_003092922.1.50734 WP_003092922.1.50814 WP_003092922.1.50922 WP_003092922.1.50967 WP_003092922.1.50989 WP_003092922.1.51019 WP_003092922.1.51035 WP_003092922.1.51136 WP_003092922.1.51141 WP_003092922.1.51173 WP_003092922.1.51183 WP_003092922.1.51185 WP_003092922.1.51267 WP_003092922.1.51273 WP_003092922.1.51457 WP_003092922.1.51472 WP_003092922.1.51538 WP_003092922.1.51549 WP_003092922.1.51585 WP_003092922.1.51682 WP_003092922.1.51733 WP_003092922.1.51807 WP_003092922.1.51847 WP_003092922.1.51889 WP_003092922.1.51917 WP_003092922.1.51928 WP_003092922.1.51937 WP_003092922.1.51943 WP_003092922.1.51957 WP_003092922.1.51976 WP_003092922.1.52043 WP_003092922.1.52146 WP_003092922.1.52152 WP_003092922.1.52212 WP_003092922.1.52220 WP_003092922.1.52244 WP_003092922.1.5226 WP_003092922.1.52326 WP_003092922.1.52334 WP_003092922.1.5235 WP_003092922.1.52355 WP_003092922.1.52372 WP_003092922.1.52403 WP_003092922.1.52409 WP_003092922.1.52449 WP_003092922.1.52500 WP_003092922.1.52537 WP_003092922.1.5258 WP_003092922.1.52583 WP_003092922.1.52591 WP_003092922.1.5260 WP_003092922.1.52690 WP_003092922.1.52700 WP_003092922.1.52728 WP_003092922.1.52784 WP_003092922.1.52790 WP_003092922.1.52810 WP_003092922.1.52850 WP_003092922.1.5289 WP_003092922.1.52939 WP_003092922.1.5294 WP_003092922.1.53037 WP_003092922.1.53038 WP_003092922.1.53070 WP_003092922.1.53072 WP_003092922.1.53169 WP_003092922.1.53267 WP_003092922.1.53287 WP_003092922.1.53351 WP_003092922.1.53371 WP_003092922.1.53414 WP_003092922.1.53427 WP_003092922.1.53486 WP_003092922.1.53528 WP_003092922.1.53530 WP_003092922.1.53586 WP_003092922.1.53663 WP_003092922.1.53678 WP_003092922.1.53719 WP_003092922.1.53726 WP_003092922.1.53826 WP_003092922.1.53932 WP_003092922.1.53946 WP_003092922.1.53948 WP_003092922.1.53951 WP_003092922.1.5399 WP_003092922.1.54003 WP_003092922.1.54076 WP_003092922.1.54078 WP_003092922.1.54090 WP_003092922.1.54133 WP_003092922.1.54140 WP_003092922.1.54146 WP_003092922.1.5420 WP_003092922.1.54248 WP_003092922.1.5427 WP_003092922.1.54354 WP_003092922.1.54462 WP_003092922.1.54497 WP_003092922.1.54742 WP_003092922.1.54809 WP_003092922.1.54974 WP_003092922.1.55 WP_003092922.1.55089 WP_003092922.1.55169 WP_003092922.1.55318 WP_003092922.1.55347 WP_003092922.1.55387 WP_003092922.1.55400 WP_003092922.1.55445 WP_003092922.1.55478 WP_003092922.1.55543 WP_003092922.1.55729 WP_003092922.1.55813 WP_003092922.1.55976 WP_003092922.1.56013 WP_003092922.1.56037 WP_003092922.1.56145 WP_003092922.1.56171 WP_003092922.1.56187 WP_003092922.1.56188 WP_003092922.1.56196 WP_003092922.1.56228 WP_003092922.1.56229 WP_003092922.1.56315 WP_003092922.1.56348 WP_003092922.1.56442 WP_003092922.1.56452 WP_003092922.1.56465 WP_003092922.1.56474 WP_003092922.1.56475 WP_003092922.1.56623 WP_003092922.1.56626 WP_003092922.1.56632 WP_003092922.1.56745 WP_003092922.1.56768 WP_003092922.1.56797 WP_003092922.1.56808 WP_003092922.1.56819 WP_003092922.1.56837 WP_003092922.1.56896 WP_003092922.1.56973 WP_003092922.1.57005 WP_003092922.1.57020 WP_003092922.1.57065 WP_003092922.1.57113 WP_003092922.1.57131 WP_003092922.1.57140 WP_003092922.1.57276 WP_003092922.1.57339 WP_003092922.1.57369 WP_003092922.1.57417 WP_003092922.1.57460 WP_003092922.1.57477 WP_003092922.1.57480 WP_003092922.1.57532 WP_003092922.1.57548 WP_003092922.1.57566 WP_003092922.1.57728 WP_003092922.1.57792 WP_003092922.1.57839 WP_003092922.1.57841 WP_003092922.1.57853 WP_003092922.1.57921 WP_003092922.1.57966 WP_003092922.1.58019 WP_003092922.1.58056 WP_003092922.1.58155 WP_003092922.1.58162 WP_003092922.1.58183 WP_003092922.1.58193 WP_003092922.1.58200 WP_003092922.1.58228 WP_003092922.1.58294 WP_003092922.1.58360 WP_003092922.1.58417 WP_003092922.1.58482 WP_003092922.1.5850 WP_003092922.1.58510 WP_003092922.1.58527 WP_003092922.1.5856 WP_003092922.1.58581 WP_003092922.1.58689 WP_003092922.1.58785 WP_003092922.1.58800 WP_003092922.1.58838 WP_003092922.1.58845 WP_003092922.1.5889 WP_003092922.1.58944 WP_003092922.1.5897 WP_003092922.1.59013 WP_003092922.1.59076 WP_003092922.1.59099 WP_003092922.1.59123 WP_003092922.1.59176 WP_003092922.1.59212 WP_003092922.1.59246 WP_003092922.1.59249 WP_003092922.1.59250 WP_003092922.1.59339 WP_003092922.1.5937 WP_003092922.1.59376 WP_003092922.1.59385 WP_003092922.1.594 WP_003092922.1.59469 WP_003092922.1.59563 WP_003092922.1.59688 WP_003092922.1.59724 WP_003092922.1.59759 WP_003092922.1.59797 WP_003092922.1.59831 WP_003092922.1.59870 WP_003092922.1.59943 WP_003092922.1.60051 WP_003092922.1.60062 WP_003092922.1.60079 WP_003092922.1.60082 WP_003092922.1.60084 WP_003092922.1.60085 WP_003092922.1.60206 WP_003092922.1.60261 WP_003092922.1.60347 WP_003092922.1.60364 WP_003092922.1.60396 WP_003092922.1.60415 WP_003092922.1.60467 WP_003092922.1.60472 WP_003092922.1.60509 WP_003092922.1.60600 WP_003092922.1.60602 WP_003092922.1.60603 WP_003092922.1.60639 WP_003092922.1.60679 WP_003092922.1.60686 WP_003092922.1.607 WP_003092922.1.60850 WP_003092922.1.60910 WP_003092922.1.60916 WP_003092922.1.60979 WP_003092922.1.61122 WP_003092922.1.61130 WP_003092922.1.61191 WP_003092922.1.61209 WP_003092922.1.61222 WP_003092922.1.61269 WP_003092922.1.61288 WP_003092922.1.61294 WP_003092922.1.61299 WP_003092922.1.6130 WP_003092922.1.61366 WP_003092922.1.61431 WP_003092922.1.61549 WP_003092922.1.61589 WP_003092922.1.61598 WP_003092922.1.616 WP_003092922.1.61696 WP_003092922.1.6173 WP_003092922.1.61943 WP_003092922.1.62010 WP_003092922.1.62035 WP_003092922.1.62180 WP_003092922.1.62186 WP_003092922.1.62211 WP_003092922.1.62263 WP_003092922.1.62357 WP_003092922.1.62396 WP_003092922.1.62410 WP_003092922.1.6242 WP_003092922.1.62483 WP_003092922.1.62516 WP_003092922.1.62534 WP_003092922.1.626 WP_003092922.1.62604 WP_003092922.1.62635 WP_003092922.1.62688 WP_003092922.1.62701 WP_003092922.1.62703 WP_003092922.1.62704 WP_003092922.1.62708 WP_003092922.1.62716 WP_003092922.1.62768 WP_003092922.1.62772 WP_003092922.1.6280 WP_003092922.1.6283 WP_003092922.1.62834 WP_003092922.1.62873 WP_003092922.1.62917 WP_003092922.1.62961 WP_003092922.1.62977 WP_003092922.1.63038 WP_003092922.1.63041 WP_003092922.1.63057 WP_003092922.1.63124 WP_003092922.1.63193 WP_003092922.1.63196 WP_003092922.1.63338 WP_003092922.1.63369 WP_003092922.1.63401 WP_003092922.1.63597 WP_003092922.1.63634 WP_003092922.1.63659 WP_003092922.1.63739 WP_003092922.1.63784 WP_003092922.1.63929 WP_003092922.1.63941 WP_003092922.1.63995 WP_003092922.1.64139 WP_003092922.1.64155 WP_003092922.1.64198 WP_003092922.1.64212 WP_003092922.1.64309 WP_003092922.1.64329 WP_003092922.1.64433 WP_003092922.1.6450 WP_003092922.1.64544 WP_003092922.1.64591 WP_003092922.1.64603 WP_003092922.1.64605 WP_003092922.1.6461 WP_003092922.1.64611 WP_003092922.1.64726 WP_003092922.1.64748 WP_003092922.1.64799 WP_003092922.1.64807 WP_003092922.1.64854 WP_003092922.1.64862 WP_003092922.1.64880 WP_003092922.1.64885 WP_003092922.1.64886 WP_003092922.1.64983 WP_003092922.1.64984 WP_003092922.1.65009 WP_003092922.1.65066 WP_003092922.1.65092 WP_003092922.1.65095 WP_003092922.1.65099 WP_003092922.1.65145 WP_003092922.1.65196 WP_003092922.1.65197 WP_003092922.1.65227 WP_003092922.1.65237 WP_003092922.1.65247 WP_003092922.1.65285 WP_003092922.1.65304 WP_003092922.1.65312 WP_003092922.1.65316 WP_003092922.1.65334 WP_003092922.1.65335 WP_003092922.1.65337 WP_003092922.1.65457 WP_003092922.1.65478 WP_003092922.1.65549 WP_003092922.1.65588 WP_003092922.1.65632 WP_003092922.1.65642 WP_003092922.1.65740 WP_003092922.1.65779 WP_003092922.1.65819 WP_003092922.1.65867 WP_003092922.1.6589 WP_003092922.1.65926 WP_003092922.1.66062 WP_003092922.1.66088 WP_003092922.1.66155 WP_003092922.1.66165 WP_003092922.1.66277 WP_003092922.1.6629 WP_003092922.1.66345 WP_003092922.1.66348 WP_003092922.1.66364 WP_003092922.1.66371 WP_003092922.1.66410 WP_003092922.1.66526 WP_003092922.1.66634 WP_003092922.1.66693 WP_003092922.1.66721 WP_003092922.1.66892 WP_003092922.1.66929 WP_003092922.1.66931 WP_003092922.1.66945 WP_003092922.1.66950 WP_003092922.1.66982 WP_003092922.1.67010 WP_003092922.1.67124 WP_003092922.1.67188 WP_003092922.1.67192 WP_003092922.1.67205 WP_003092922.1.67261 WP_003092922.1.67269 WP_003092922.1.6734 WP_003092922.1.67370 WP_003092922.1.67388 WP_003092922.1.67472 WP_003092922.1.67489 WP_003092922.1.67506 WP_003092922.1.67526 WP_003092922.1.67531 WP_003092922.1.67545 WP_003092922.1.6768 WP_003092922.1.67686 WP_003092922.1.67755 WP_003092922.1.67830 WP_003092922.1.67874 WP_003092922.1.67875 WP_003092922.1.67899 WP_003092922.1.67903 WP_003092922.1.67948 WP_003092922.1.6796 WP_003092922.1.68000 WP_003092922.1.6808 WP_003092922.1.68158 WP_003092922.1.68162 WP_003092922.1.68172 WP_003092922.1.68183 WP_003092922.1.68194 WP_003092922.1.68252 WP_003092922.1.68317 WP_003092922.1.68446 WP_003092922.1.68448 WP_003092922.1.68499 WP_003092922.1.6850 WP_003092922.1.68541 WP_003092922.1.68561 WP_003092922.1.68568 WP_003092922.1.68638 WP_003092922.1.6866 WP_003092922.1.68756 WP_003092922.1.68781 WP_003092922.1.68800 WP_003092922.1.68802 WP_003092922.1.68850 WP_003092922.1.68857 WP_003092922.1.68862 WP_003092922.1.68910 WP_003092922.1.68938 WP_003092922.1.68979 WP_003092922.1.69088 WP_003092922.1.6911 WP_003092922.1.69159 WP_003092922.1.69209 WP_003092922.1.69260 WP_003092922.1.6928 WP_003092922.1.6931 WP_003092922.1.69330 WP_003092922.1.6937 WP_003092922.1.69411 WP_003092922.1.69534 WP_003092922.1.69556 WP_003092922.1.69599 WP_003092922.1.69702 WP_003092922.1.69788 WP_003092922.1.69791 WP_003092922.1.69819 WP_003092922.1.69834 WP_003092922.1.69907 WP_003092922.1.69993 WP_003092922.1.70092 WP_003092922.1.70098 WP_003092922.1.70138 WP_003092922.1.70194 WP_003092922.1.70216 WP_003092922.1.70229 WP_003092922.1.70460 WP_003092922.1.70470 WP_003092922.1.70537 WP_003092922.1.70561 WP_003092922.1.70583 WP_003092922.1.70648 WP_003092922.1.70650 WP_003092922.1.70670 WP_003092922.1.7077 WP_003092922.1.70778 WP_003092922.1.70831 WP_003092922.1.70991 WP_003092922.1.71038 WP_003092922.1.71203 WP_003092922.1.71234 WP_003092922.1.71249 WP_003092922.1.71254 WP_003092922.1.71290 WP_003092922.1.71385 WP_003092922.1.71570 WP_003092922.1.71610 WP_003092922.1.7163 WP_003092922.1.71642 WP_003092922.1.71666 WP_003092922.1.71738 WP_003092922.1.71799 WP_003092922.1.71806 WP_003092922.1.71822 WP_003092922.1.71862 WP_003092922.1.71866 WP_003092922.1.71891 WP_003092922.1.71927 WP_003092922.1.71934 WP_003092922.1.72149 WP_003092922.1.72167 WP_003092922.1.72181 WP_003092922.1.7219 WP_003092922.1.72287 WP_003092922.1.72323 WP_003092922.1.72331 WP_003092922.1.72346 WP_003092922.1.72378 WP_003092922.1.72447 WP_003092922.1.72458 WP_003092922.1.72477 WP_003092922.1.72541 WP_003092922.1.72562 WP_003092922.1.72570 WP_003092922.1.72653 WP_003092922.1.72662 WP_003092922.1.72669 WP_003092922.1.72727 WP_003092922.1.7276 WP_003092922.1.72768 WP_003092922.1.72772 WP_003092922.1.72782 WP_003092922.1.72920 WP_003092922.1.73035 WP_003092922.1.73048 WP_003092922.1.7308 WP_003092922.1.73135 WP_003092922.1.73149 WP_003092922.1.73172 WP_003092922.1.73192 WP_003092922.1.7327 WP_003092922.1.7329 WP_003092922.1.733 WP_003092922.1.73455 WP_003092922.1.73490 WP_003092922.1.73523 WP_003092922.1.73541 WP_003092922.1.73601 WP_003092922.1.73651 WP_003092922.1.73719 WP_003092922.1.73728 WP_003092922.1.7377 WP_003092922.1.73791 WP_003092922.1.7382 WP_003092922.1.73860 WP_003092922.1.73889 WP_003092922.1.73911 WP_003092922.1.73941 WP_003092922.1.74 WP_003092922.1.74000 WP_003092922.1.74072 WP_003092922.1.74074 WP_003092922.1.7408 WP_003092922.1.74106 WP_003092922.1.74167 WP_003092922.1.74175 WP_003092922.1.74180 WP_003092922.1.74182 WP_003092922.1.74219 WP_003092922.1.74264 WP_003092922.1.74268 WP_003092922.1.74281 WP_003092922.1.74287 WP_003092922.1.74326 WP_003092922.1.74458 WP_003092922.1.74473 WP_003092922.1.7448 WP_003092922.1.74518 WP_003092922.1.7456 WP_003092922.1.74568 WP_003092922.1.74604 WP_003092922.1.74629 WP_003092922.1.74637 WP_003092922.1.74685 WP_003092922.1.74772 WP_003092922.1.74776 WP_003092922.1.748 WP_003092922.1.74878 WP_003092922.1.74948 WP_003092922.1.74958 WP_003092922.1.7501 WP_003092922.1.75041 WP_003092922.1.75119 WP_003092922.1.75204 WP_003092922.1.75277 WP_003092922.1.75303 WP_003092922.1.75389 WP_003092922.1.75431 WP_003092922.1.7547 WP_003092922.1.75549 WP_003092922.1.75573 WP_003092922.1.75580 WP_003092922.1.75599 WP_003092922.1.75603 WP_003092922.1.75631 WP_003092922.1.7568 WP_003092922.1.75756 WP_003092922.1.75771 WP_003092922.1.75792 WP_003092922.1.75825 WP_003092922.1.75860 WP_003092922.1.75935 WP_003092922.1.75938 WP_003092922.1.7595 WP_003092922.1.76077 WP_003092922.1.76092 WP_003092922.1.76141 WP_003092922.1.76145 WP_003092922.1.76192 WP_003092922.1.76322 WP_003092922.1.76355 WP_003092922.1.76383 WP_003092922.1.76399 WP_003092922.1.76441 WP_003092922.1.76467 WP_003092922.1.76484 WP_003092922.1.76543 WP_003092922.1.76600 WP_003092922.1.76633 WP_003092922.1.7666 WP_003092922.1.76716 WP_003092922.1.76775 WP_003092922.1.76791 WP_003092922.1.76861 WP_003092922.1.76922 WP_003092922.1.77235 WP_003092922.1.77238 WP_003092922.1.77286 WP_003092922.1.77317 WP_003092922.1.77442 WP_003092922.1.77490 WP_003092922.1.77566 WP_003092922.1.77574 WP_003092922.1.77587 WP_003092922.1.77686 WP_003092922.1.77750 WP_003092922.1.77769 WP_003092922.1.7779 WP_003092922.1.77819 WP_003092922.1.77834 WP_003092922.1.77913 WP_003092922.1.78104 WP_003092922.1.78112 WP_003092922.1.78118 WP_003092922.1.78134 WP_003092922.1.78148 WP_003092922.1.78158 WP_003092922.1.78280 WP_003092922.1.78288 WP_003092922.1.78380 WP_003092922.1.7840 WP_003092922.1.78409 WP_003092922.1.78425 WP_003092922.1.78430 WP_003092922.1.78437 WP_003092922.1.78570 WP_003092922.1.78599 WP_003092922.1.78623 WP_003092922.1.78669 WP_003092922.1.78693 WP_003092922.1.78795 WP_003092922.1.78810 WP_003092922.1.78926 WP_003092922.1.78947 WP_003092922.1.78954 WP_003092922.1.78986 WP_003092922.1.7899 WP_003092922.1.79003 WP_003092922.1.79007 WP_003092922.1.79053 WP_003092922.1.79060 WP_003092922.1.79177 WP_003092922.1.79193 WP_003092922.1.79256 WP_003092922.1.79279 WP_003092922.1.79311 WP_003092922.1.79357 WP_003092922.1.79364 WP_003092922.1.79421 WP_003092922.1.79429 WP_003092922.1.79431 WP_003092922.1.7945 WP_003092922.1.79463 WP_003092922.1.79507 WP_003092922.1.7953 WP_003092922.1.79544 WP_003092922.1.79569 WP_003092922.1.79601 WP_003092922.1.79631 WP_003092922.1.79754 WP_003092922.1.79788 WP_003092922.1.79862 WP_003092922.1.79883 WP_003092922.1.79902 WP_003092922.1.79908 WP_003092922.1.79986 WP_003092922.1.8 WP_003092922.1.80033 WP_003092922.1.80087 WP_003092922.1.8028 WP_003092922.1.80306 WP_003092922.1.8038 WP_003092922.1.80410 WP_003092922.1.80454 WP_003092922.1.80481 WP_003092922.1.8051 WP_003092922.1.80535 WP_003092922.1.80572 WP_003092922.1.80627 WP_003092922.1.80632 WP_003092922.1.8064 WP_003092922.1.80644 WP_003092922.1.80645 WP_003092922.1.80683 WP_003092922.1.80715 WP_003092922.1.80785 WP_003092922.1.80846 WP_003092922.1.80880 WP_003092922.1.80892 WP_003092922.1.80910 WP_003092922.1.80926 WP_003092922.1.80929 WP_003092922.1.80931 WP_003092922.1.80938 WP_003092922.1.81081 WP_003092922.1.81082 WP_003092922.1.81206 WP_003092922.1.81331 WP_003092922.1.81338 WP_003092922.1.81349 WP_003092922.1.81368 WP_003092922.1.81380 WP_003092922.1.8141 WP_003092922.1.81426 WP_003092922.1.81470 WP_003092922.1.81482 WP_003092922.1.81487 WP_003092922.1.81581 WP_003092922.1.81591 WP_003092922.1.81622 WP_003092922.1.81643 WP_003092922.1.81708 WP_003092922.1.81728 WP_003092922.1.81742 WP_003092922.1.81748 WP_003092922.1.81771 WP_003092922.1.81784 WP_003092922.1.81802 WP_003092922.1.81816 WP_003092922.1.81834 WP_003092922.1.81844 WP_003092922.1.81856 WP_003092922.1.81874 WP_003092922.1.81927 WP_003092922.1.81950 WP_003092922.1.81957 WP_003092922.1.81960 WP_003092922.1.81986 WP_003092922.1.82117 WP_003092922.1.82127 WP_003092922.1.82178 WP_003092922.1.82260 WP_003092922.1.8227 WP_003092922.1.82310 WP_003092922.1.82312 WP_003092922.1.82328 WP_003092922.1.82334 WP_003092922.1.8238 WP_003092922.1.82442 WP_003092922.1.82487 WP_003092922.1.82580 WP_003092922.1.82604 WP_003092922.1.82606 WP_003092922.1.82620 WP_003092922.1.82643 WP_003092922.1.82710 WP_003092922.1.82798 WP_003092922.1.82810 WP_003092922.1.8284 WP_003092922.1.82864 WP_003092922.1.82882 WP_003092922.1.82887 WP_003092922.1.82936 WP_003092922.1.83025 WP_003092922.1.83131 WP_003092922.1.83184 WP_003092922.1.83213 WP_003092922.1.83251 WP_003092922.1.83267 WP_003092922.1.83296 WP_003092922.1.83317 WP_003092922.1.83374 WP_003092922.1.83394 WP_003092922.1.83440 WP_003092922.1.83460 WP_003092922.1.83463 WP_003092922.1.835 WP_003092922.1.83503 WP_003092922.1.8351 WP_003092922.1.8353 WP_003092922.1.83540 WP_003092922.1.8357 WP_003092922.1.83637 WP_003092922.1.83673 WP_003092922.1.83698 WP_003092922.1.83715 WP_003092922.1.83871 WP_003092922.1.83937 WP_003092922.1.83946 WP_003092922.1.84003 WP_003092922.1.84008 WP_003092922.1.84138 WP_003092922.1.84162 WP_003092922.1.84174 WP_003092922.1.84177 WP_003092922.1.84178 WP_003092922.1.84190 WP_003092922.1.84203 WP_003092922.1.84271 WP_003092922.1.84297 WP_003092922.1.8437 WP_003092922.1.84374 WP_003092922.1.84398 WP_003092922.1.84404 WP_003092922.1.84439 WP_003092922.1.84471 WP_003092922.1.84487 WP_003092922.1.8453 WP_003092922.1.84538 WP_003092922.1.84558 WP_003092922.1.84589 WP_003092922.1.84674 WP_003092922.1.84684 WP_003092922.1.84702 WP_003092922.1.84715 WP_003092922.1.84754 WP_003092922.1.84792 WP_003092922.1.84825 WP_003092922.1.8484 WP_003092922.1.84937 WP_003092922.1.84946 WP_003092922.1.8498 WP_003092922.1.85018 WP_003092922.1.85028 WP_003092922.1.85059 WP_003092922.1.85150 WP_003092922.1.85220 WP_003092922.1.85290 WP_003092922.1.85298 WP_003092922.1.85303 WP_003092922.1.85311 WP_003092922.1.85318 WP_003092922.1.85357 WP_003092922.1.85446 WP_003092922.1.85453 WP_003092922.1.85574 WP_003092922.1.85633 WP_003092922.1.85638 WP_003092922.1.85788 WP_003092922.1.85897 WP_003092922.1.85910 WP_003092922.1.85920 WP_003092922.1.85978 WP_003092922.1.86002 WP_003092922.1.86047 WP_003092922.1.86055 WP_003092922.1.86058 WP_003092922.1.861 WP_003092922.1.86125 WP_003092922.1.86182 WP_003092922.1.86243 WP_003092922.1.86278 WP_003092922.1.86287 WP_003092922.1.86293 WP_003092922.1.86386 WP_003092922.1.86432 WP_003092922.1.8645 WP_003092922.1.865 WP_003092922.1.86506 WP_003092922.1.86545 WP_003092922.1.86552 WP_003092922.1.86554 WP_003092922.1.86595 WP_003092922.1.86652 WP_003092922.1.86665 WP_003092922.1.867 WP_003092922.1.86708 WP_003092922.1.86733 WP_003092922.1.86774 WP_003092922.1.86780 WP_003092922.1.86785 WP_003092922.1.86796 WP_003092922.1.86813 WP_003092922.1.86822 WP_003092922.1.8693 WP_003092922.1.86947 WP_003092922.1.86970 WP_003092922.1.86985 WP_003092922.1.87104 WP_003092922.1.87163 WP_003092922.1.8718 WP_003092922.1.87182 WP_003092922.1.87183 WP_003092922.1.8727 WP_003092922.1.87316 WP_003092922.1.87390 WP_003092922.1.87435 WP_003092922.1.8749 WP_003092922.1.87530 WP_003092922.1.87547 WP_003092922.1.87648 WP_003092922.1.87763 WP_003092922.1.8777 WP_003092922.1.8785 WP_003092922.1.87877 WP_003092922.1.87888 WP_003092922.1.87970 WP_003092922.1.87975 WP_003092922.1.87981 WP_003092922.1.87987 WP_003092922.1.88004 WP_003092922.1.88308 WP_003092922.1.88330 WP_003092922.1.88360 WP_003092922.1.88388 WP_003092922.1.88415 WP_003092922.1.88517 WP_003092922.1.8852 WP_003092922.1.88540 WP_003092922.1.88578 WP_003092922.1.88605 WP_003092922.1.88659 WP_003092922.1.88679 WP_003092922.1.88680 WP_003092922.1.88714 WP_003092922.1.88750 WP_003092922.1.889 WP_003092922.1.88900 WP_003092922.1.88949 WP_003092922.1.88969 WP_003092922.1.89083 WP_003092922.1.89098 WP_003092922.1.8911 WP_003092922.1.89234 WP_003092922.1.89245 WP_003092922.1.89266 WP_003092922.1.89276 WP_003092922.1.89409 WP_003092922.1.89434 WP_003092922.1.89440 WP_003092922.1.89480 WP_003092922.1.8949 WP_003092922.1.89491 WP_003092922.1.89523 WP_003092922.1.89577 WP_003092922.1.89610 WP_003092922.1.89638 WP_003092922.1.89662 WP_003092922.1.89669 WP_003092922.1.89736 WP_003092922.1.8976 WP_003092922.1.89776 WP_003092922.1.89805 WP_003092922.1.89866 WP_003092922.1.89867 WP_003092922.1.89868 WP_003092922.1.89871 WP_003092922.1.89886 WP_003092922.1.89992 WP_003092922.1.90024 WP_003092922.1.90032 WP_003092922.1.90056 WP_003092922.1.90110 WP_003092922.1.90141 WP_003092922.1.90150 WP_003092922.1.90189 WP_003092922.1.90224 WP_003092922.1.90225 WP_003092922.1.90242 WP_003092922.1.90268 WP_003092922.1.90272 WP_003092922.1.90306 WP_003092922.1.90412 WP_003092922.1.9056 WP_003092922.1.90569 WP_003092922.1.90655 WP_003092922.1.90770 WP_003092922.1.90940 WP_003092922.1.90999 WP_003092922.1.91012 WP_003092922.1.91093 WP_003092922.1.91161 WP_003092922.1.9120 WP_003092922.1.91204 WP_003092922.1.91236 WP_003092922.1.91281 WP_003092922.1.91307 WP_003092922.1.91336 WP_003092922.1.91360 WP_003092922.1.91392 WP_003092922.1.91416 WP_003092922.1.9143 WP_003092922.1.91431 WP_003092922.1.91438 WP_003092922.1.91467 WP_003092922.1.91527 WP_003092922.1.91563 WP_003092922.1.91585 WP_003092922.1.91803 WP_003092922.1.9182 WP_003092922.1.91838 WP_003092922.1.91846 WP_003092922.1.91860 WP_003092922.1.91862 WP_003092922.1.91882 WP_003092922.1.9191 WP_003092922.1.91938 WP_003092922.1.91996 WP_003092922.1.92175 WP_003092922.1.92314 WP_003092922.1.92321 WP_003092922.1.92357 WP_003092922.1.92454 WP_003092922.1.92573 WP_003092922.1.92587 WP_003092922.1.92589 WP_003092922.1.92594 WP_003092922.1.92624 WP_003092922.1.92630 WP_003092922.1.92642 WP_003092922.1.9272 WP_003092922.1.92759 WP_003092922.1.92769 WP_003092922.1.92839 WP_003092922.1.92847 WP_003092922.1.92894 WP_003092922.1.92924 WP_003092922.1.92930 WP_003092922.1.93001 WP_003092922.1.93090 WP_003092922.1.93122 WP_003092922.1.93144 WP_003092922.1.93148 WP_003092922.1.93196 WP_003092922.1.93250 WP_003092922.1.93264 WP_003092922.1.9328 WP_003092922.1.93446 WP_003092922.1.9349 WP_003092922.1.93493 WP_003092922.1.93498 WP_003092922.1.93520 WP_003092922.1.93547 WP_003092922.1.93562 WP_003092922.1.93568 WP_003092922.1.93797 WP_003092922.1.93848 WP_003092922.1.93889 WP_003092922.1.93897 WP_003092922.1.94004 WP_003092922.1.94031 WP_003092922.1.94065 WP_003092922.1.94078 WP_003092922.1.94136 WP_003092922.1.94174 WP_003092922.1.94211 WP_003092922.1.94218 WP_003092922.1.94221 WP_003092922.1.94230 WP_003092922.1.94243 WP_003092922.1.94285 WP_003092922.1.94288 WP_003092922.1.94333 WP_003092922.1.94385 WP_003092922.1.94434 WP_003092922.1.9444 WP_003092922.1.94682 WP_003092922.1.94732 WP_003092922.1.94814 WP_003092922.1.94818 WP_003092922.1.94856 WP_003092922.1.94874 WP_003092922.1.94881 WP_003092922.1.94896 WP_003092922.1.94897 WP_003092922.1.94943 WP_003092922.1.95018 WP_003092922.1.95025 WP_003092922.1.95027 WP_003092922.1.95056 WP_003092922.1.95117 WP_003092922.1.95132 WP_003092922.1.95187 WP_003092922.1.95207 WP_003092922.1.95217 WP_003092922.1.95305 WP_003092922.1.95324 WP_003092922.1.95354 WP_003092922.1.95359 WP_003092922.1.95460 WP_003092922.1.95488 WP_003092922.1.95525 WP_003092922.1.95536 WP_003092922.1.95638 WP_003092922.1.95668 WP_003092922.1.95745 WP_003092922.1.95751 WP_003092922.1.95774 WP_003092922.1.95782 WP_003092922.1.95787 WP_003092922.1.95802 WP_003092922.1.95820 WP_003092922.1.95825 WP_003092922.1.9599 WP_003092922.1.95994 WP_003092922.1.96008 WP_003092922.1.96041 WP_003092922.1.96058 WP_003092922.1.961 WP_003092922.1.96134 WP_003092922.1.96193 WP_003092922.1.96243 WP_003092922.1.96267 WP_003092922.1.96357 WP_003092922.1.96384 WP_003092922.1.96434 WP_003092922.1.96452 WP_003092922.1.96506 WP_003092922.1.96667 WP_003092922.1.96702 WP_003092922.1.96714 WP_003092922.1.96863 WP_003092922.1.96880 WP_003092922.1.96967 WP_003092922.1.9706 WP_003092922.1.97118 WP_003092922.1.97126 WP_003092922.1.97204 WP_003092922.1.97213 WP_003092922.1.9722 WP_003092922.1.97271 WP_003092922.1.97272 WP_003092922.1.97377 WP_003092922.1.97461 WP_003092922.1.97474 WP_003092922.1.97499 WP_003092922.1.97503 WP_003092922.1.97521 WP_003092922.1.97583 WP_003092922.1.97614 WP_003092922.1.977 WP_003092922.1.97784 WP_003092922.1.97826 WP_003092922.1.97877 WP_003092922.1.97968 WP_003092922.1.98111 WP_003092922.1.98260 WP_003092922.1.98276 WP_003092922.1.98308 WP_003092922.1.98410 WP_003092922.1.98414 WP_003092922.1.98433 WP_003092922.1.985 WP_003092922.1.98515 WP_003092922.1.98522 WP_003092922.1.98573 WP_003092922.1.98600 WP_003092922.1.98610 WP_003092922.1.98672 WP_003092922.1.98678 WP_003092922.1.98693 WP_003092922.1.98718 WP_003092922.1.98788 WP_003092922.1.98814 WP_003092922.1.9885 WP_003092922.1.98873 WP_003092922.1.98926 WP_003092922.1.98958 WP_003092922.1.98960 WP_003092922.1.98963 WP_003092922.1.99065 WP_003092922.1.99068 WP_003092922.1.99103 WP_003092922.1.99214 WP_003092922.1.99293 WP_003092922.1.99353 WP_003092922.1.99378 WP_003092922.1.99386 WP_003092922.1.99389 WP_003092922.1.99461 WP_003092922.1.9951 WP_003092922.1.99516 WP_003092922.1.99647 WP_003092922.1.99654 WP_003092922.1.99662 WP_003092922.1.99746 WP_003092922.1.99757 WP_003092922.1.99772 WP_003092922.1.99795 WP_003092922.1.99835 WP_003092922.1.9989 WP_003092922.1.99930 gi|568152260|ref|YP_008941208.1| gi|116051886|ref|YP_789271.1| gi|478477282|ref|YP_007707933.1| gi|558674037|ref|YP_008810745.1| 208963.PA14_14140 208964.PA3855 557722.PLES_11191 gi|564951000|ref|YP_008883570.1| gi|558667686|ref|YP_008804396.1| gi|15599050|ref|NP_252544.1| gi|218889861|ref|YP_002438725.1| PaR210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]