SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152263|ref|YP_008941211.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152263|ref|YP_008941211.1|
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000151
Family Glutathione S-transferase (GST), N-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 139-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000108
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568152263|ref|YP_008941211.1|
Sequence length 311
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MSELILHHYPTSPFAEKARLLLGFKQLSWRSVMIPPVMPKPDLVALTGGYRKTPVLQVGA
DVYCDTALIARRLEQEKAVPALFPEGQEMVAASFAQWADAVLFQHAVSLAFAPESIAVRF
GKLPPEFLKAFMADRSQLFSGGSAGRLPLEQARHQWPAFMARLERQLSREDGDFLFGEAS
VADFAVAHCLWFLKGTPVTAPLVDDYPQVQAWLGRVLGFGHGAPAEMSAEEALEVARGSQ
PAALPDESFSDPNGFLPGQAVAIAATDYGVDAVQGELLFAGSEELILRREDPRAGTVHVH
FPRLGFRIEAR
Download sequence
Identical sequences A0A072ZEF1 A0A0H3R8F3 A0A1F0IGI2 A0A1G5LIF5 A0A1S1BV52 Q9HXF4 V6AA11
208964.PA3852 557722.PLES_11221 gi|568152263|ref|YP_008941211.1| NP_252541.1.87394 WP_003092916.1.100276 WP_003092916.1.100394 WP_003092916.1.100456 WP_003092916.1.100469 WP_003092916.1.100473 WP_003092916.1.100523 WP_003092916.1.100654 WP_003092916.1.100723 WP_003092916.1.100742 WP_003092916.1.100777 WP_003092916.1.100786 WP_003092916.1.100808 WP_003092916.1.100809 WP_003092916.1.100872 WP_003092916.1.100983 WP_003092916.1.101021 WP_003092916.1.101340 WP_003092916.1.101506 WP_003092916.1.101572 WP_003092916.1.101590 WP_003092916.1.101712 WP_003092916.1.101739 WP_003092916.1.10174 WP_003092916.1.101781 WP_003092916.1.10185 WP_003092916.1.101863 WP_003092916.1.101871 WP_003092916.1.10201 WP_003092916.1.10204 WP_003092916.1.10271 WP_003092916.1.10407 WP_003092916.1.10419 WP_003092916.1.10435 WP_003092916.1.10457 WP_003092916.1.10468 WP_003092916.1.10477 WP_003092916.1.10482 WP_003092916.1.10513 WP_003092916.1.10529 WP_003092916.1.10636 WP_003092916.1.10684 WP_003092916.1.10901 WP_003092916.1.11026 WP_003092916.1.11058 WP_003092916.1.1109 WP_003092916.1.11130 WP_003092916.1.11163 WP_003092916.1.11381 WP_003092916.1.11410 WP_003092916.1.11417 WP_003092916.1.11454 WP_003092916.1.11568 WP_003092916.1.11569 WP_003092916.1.1183 WP_003092916.1.11854 WP_003092916.1.1187 WP_003092916.1.11943 WP_003092916.1.12018 WP_003092916.1.12081 WP_003092916.1.12120 WP_003092916.1.12208 WP_003092916.1.12354 WP_003092916.1.1238 WP_003092916.1.12530 WP_003092916.1.12561 WP_003092916.1.12657 WP_003092916.1.12660 WP_003092916.1.12670 WP_003092916.1.12687 WP_003092916.1.12797 WP_003092916.1.12890 WP_003092916.1.12891 WP_003092916.1.12922 WP_003092916.1.12930 WP_003092916.1.12980 WP_003092916.1.13077 WP_003092916.1.13208 WP_003092916.1.13232 WP_003092916.1.13242 WP_003092916.1.13266 WP_003092916.1.1333 WP_003092916.1.13364 WP_003092916.1.13407 WP_003092916.1.13529 WP_003092916.1.13533 WP_003092916.1.13642 WP_003092916.1.13758 WP_003092916.1.13785 WP_003092916.1.13795 WP_003092916.1.13828 WP_003092916.1.13865 WP_003092916.1.14049 WP_003092916.1.14078 WP_003092916.1.14096 WP_003092916.1.14116 WP_003092916.1.14204 WP_003092916.1.14378 WP_003092916.1.14424 WP_003092916.1.14460 WP_003092916.1.14463 WP_003092916.1.14525 WP_003092916.1.14564 WP_003092916.1.14615 WP_003092916.1.14679 WP_003092916.1.14690 WP_003092916.1.14714 WP_003092916.1.1475 WP_003092916.1.14754 WP_003092916.1.14797 WP_003092916.1.14839 WP_003092916.1.14966 WP_003092916.1.14981 WP_003092916.1.152 WP_003092916.1.15222 WP_003092916.1.15231 WP_003092916.1.15281 WP_003092916.1.15297 WP_003092916.1.15373 WP_003092916.1.15379 WP_003092916.1.15408 WP_003092916.1.15480 WP_003092916.1.15482 WP_003092916.1.15606 WP_003092916.1.15666 WP_003092916.1.15692 WP_003092916.1.15886 WP_003092916.1.15889 WP_003092916.1.16041 WP_003092916.1.16074 WP_003092916.1.16142 WP_003092916.1.16197 WP_003092916.1.162 WP_003092916.1.16239 WP_003092916.1.16242 WP_003092916.1.16267 WP_003092916.1.16419 WP_003092916.1.1646 WP_003092916.1.16660 WP_003092916.1.16694 WP_003092916.1.1670 WP_003092916.1.16782 WP_003092916.1.16808 WP_003092916.1.16895 WP_003092916.1.17022 WP_003092916.1.17155 WP_003092916.1.17162 WP_003092916.1.17189 WP_003092916.1.17353 WP_003092916.1.17354 WP_003092916.1.17370 WP_003092916.1.17397 WP_003092916.1.17499 WP_003092916.1.1758 WP_003092916.1.1761 WP_003092916.1.18052 WP_003092916.1.18054 WP_003092916.1.18117 WP_003092916.1.18199 WP_003092916.1.18204 WP_003092916.1.18234 WP_003092916.1.1824 WP_003092916.1.18349 WP_003092916.1.18493 WP_003092916.1.18653 WP_003092916.1.18728 WP_003092916.1.18732 WP_003092916.1.18735 WP_003092916.1.18769 WP_003092916.1.18852 WP_003092916.1.18892 WP_003092916.1.18911 WP_003092916.1.18930 WP_003092916.1.19260 WP_003092916.1.19269 WP_003092916.1.19376 WP_003092916.1.1938 WP_003092916.1.19552 WP_003092916.1.19591 WP_003092916.1.19703 WP_003092916.1.1971 WP_003092916.1.19824 WP_003092916.1.19931 WP_003092916.1.20024 WP_003092916.1.20070 WP_003092916.1.20125 WP_003092916.1.20134 WP_003092916.1.20154 WP_003092916.1.20216 WP_003092916.1.20342 WP_003092916.1.20590 WP_003092916.1.20682 WP_003092916.1.20692 WP_003092916.1.20854 WP_003092916.1.21002 WP_003092916.1.21039 WP_003092916.1.21100 WP_003092916.1.21166 WP_003092916.1.21209 WP_003092916.1.21253 WP_003092916.1.21302 WP_003092916.1.21358 WP_003092916.1.2144 WP_003092916.1.21460 WP_003092916.1.21469 WP_003092916.1.21471 WP_003092916.1.21517 WP_003092916.1.21744 WP_003092916.1.21782 WP_003092916.1.21801 WP_003092916.1.21871 WP_003092916.1.21891 WP_003092916.1.22078 WP_003092916.1.221 WP_003092916.1.2228 WP_003092916.1.22316 WP_003092916.1.2237 WP_003092916.1.22394 WP_003092916.1.22442 WP_003092916.1.22477 WP_003092916.1.22573 WP_003092916.1.22671 WP_003092916.1.22704 WP_003092916.1.22729 WP_003092916.1.22863 WP_003092916.1.23013 WP_003092916.1.23195 WP_003092916.1.2323 WP_003092916.1.23418 WP_003092916.1.23421 WP_003092916.1.23523 WP_003092916.1.23525 WP_003092916.1.23559 WP_003092916.1.236 WP_003092916.1.23611 WP_003092916.1.23715 WP_003092916.1.23739 WP_003092916.1.23769 WP_003092916.1.23794 WP_003092916.1.23925 WP_003092916.1.23967 WP_003092916.1.23983 WP_003092916.1.24077 WP_003092916.1.24087 WP_003092916.1.24351 WP_003092916.1.24447 WP_003092916.1.2453 WP_003092916.1.24626 WP_003092916.1.24662 WP_003092916.1.2477 WP_003092916.1.24851 WP_003092916.1.24862 WP_003092916.1.24879 WP_003092916.1.24938 WP_003092916.1.24940 WP_003092916.1.25052 WP_003092916.1.25075 WP_003092916.1.251 WP_003092916.1.25109 WP_003092916.1.2511 WP_003092916.1.25142 WP_003092916.1.25179 WP_003092916.1.25191 WP_003092916.1.25271 WP_003092916.1.25328 WP_003092916.1.25344 WP_003092916.1.2535 WP_003092916.1.25641 WP_003092916.1.25675 WP_003092916.1.25695 WP_003092916.1.2572 WP_003092916.1.25903 WP_003092916.1.2596 WP_003092916.1.26010 WP_003092916.1.26025 WP_003092916.1.26301 WP_003092916.1.26334 WP_003092916.1.26428 WP_003092916.1.26463 WP_003092916.1.26489 WP_003092916.1.2652 WP_003092916.1.26592 WP_003092916.1.26604 WP_003092916.1.26740 WP_003092916.1.26816 WP_003092916.1.26841 WP_003092916.1.26906 WP_003092916.1.26967 WP_003092916.1.27028 WP_003092916.1.27039 WP_003092916.1.27107 WP_003092916.1.27211 WP_003092916.1.27259 WP_003092916.1.27288 WP_003092916.1.27549 WP_003092916.1.27575 WP_003092916.1.27587 WP_003092916.1.27687 WP_003092916.1.27772 WP_003092916.1.27783 WP_003092916.1.27825 WP_003092916.1.27837 WP_003092916.1.27966 WP_003092916.1.28057 WP_003092916.1.28064 WP_003092916.1.28078 WP_003092916.1.283 WP_003092916.1.28316 WP_003092916.1.28329 WP_003092916.1.28383 WP_003092916.1.28404 WP_003092916.1.28505 WP_003092916.1.28528 WP_003092916.1.28602 WP_003092916.1.28623 WP_003092916.1.28699 WP_003092916.1.28713 WP_003092916.1.28800 WP_003092916.1.28823 WP_003092916.1.28838 WP_003092916.1.28878 WP_003092916.1.29008 WP_003092916.1.29062 WP_003092916.1.29070 WP_003092916.1.29137 WP_003092916.1.2927 WP_003092916.1.29438 WP_003092916.1.29440 WP_003092916.1.29472 WP_003092916.1.2948 WP_003092916.1.29498 WP_003092916.1.29577 WP_003092916.1.2961 WP_003092916.1.29633 WP_003092916.1.29650 WP_003092916.1.29668 WP_003092916.1.29753 WP_003092916.1.29767 WP_003092916.1.29848 WP_003092916.1.29958 WP_003092916.1.29973 WP_003092916.1.30020 WP_003092916.1.3030 WP_003092916.1.30474 WP_003092916.1.30475 WP_003092916.1.30614 WP_003092916.1.30693 WP_003092916.1.3072 WP_003092916.1.30740 WP_003092916.1.30815 WP_003092916.1.30842 WP_003092916.1.30943 WP_003092916.1.30973 WP_003092916.1.30994 WP_003092916.1.31279 WP_003092916.1.31361 WP_003092916.1.31501 WP_003092916.1.31565 WP_003092916.1.31633 WP_003092916.1.31732 WP_003092916.1.31741 WP_003092916.1.31751 WP_003092916.1.3179 WP_003092916.1.31848 WP_003092916.1.31852 WP_003092916.1.3189 WP_003092916.1.31939 WP_003092916.1.32134 WP_003092916.1.32137 WP_003092916.1.32235 WP_003092916.1.32289 WP_003092916.1.32314 WP_003092916.1.32523 WP_003092916.1.32544 WP_003092916.1.32596 WP_003092916.1.32626 WP_003092916.1.32641 WP_003092916.1.32821 WP_003092916.1.32869 WP_003092916.1.32879 WP_003092916.1.32998 WP_003092916.1.33097 WP_003092916.1.33186 WP_003092916.1.33204 WP_003092916.1.33210 WP_003092916.1.33340 WP_003092916.1.33387 WP_003092916.1.33517 WP_003092916.1.33728 WP_003092916.1.33824 WP_003092916.1.3385 WP_003092916.1.33945 WP_003092916.1.34039 WP_003092916.1.34136 WP_003092916.1.34143 WP_003092916.1.34150 WP_003092916.1.34151 WP_003092916.1.34191 WP_003092916.1.34203 WP_003092916.1.34461 WP_003092916.1.34472 WP_003092916.1.3452 WP_003092916.1.34568 WP_003092916.1.34583 WP_003092916.1.34625 WP_003092916.1.34689 WP_003092916.1.34784 WP_003092916.1.34821 WP_003092916.1.34832 WP_003092916.1.34836 WP_003092916.1.34837 WP_003092916.1.34876 WP_003092916.1.34878 WP_003092916.1.34901 WP_003092916.1.34922 WP_003092916.1.35036 WP_003092916.1.35104 WP_003092916.1.35149 WP_003092916.1.35231 WP_003092916.1.3531 WP_003092916.1.35353 WP_003092916.1.3540 WP_003092916.1.35431 WP_003092916.1.35480 WP_003092916.1.35512 WP_003092916.1.35529 WP_003092916.1.3555 WP_003092916.1.35573 WP_003092916.1.35599 WP_003092916.1.35639 WP_003092916.1.35641 WP_003092916.1.35669 WP_003092916.1.3568 WP_003092916.1.3576 WP_003092916.1.35762 WP_003092916.1.35822 WP_003092916.1.35857 WP_003092916.1.35984 WP_003092916.1.36266 WP_003092916.1.36285 WP_003092916.1.36378 WP_003092916.1.36435 WP_003092916.1.36487 WP_003092916.1.36521 WP_003092916.1.3653 WP_003092916.1.3662 WP_003092916.1.36665 WP_003092916.1.36781 WP_003092916.1.36879 WP_003092916.1.37125 WP_003092916.1.37172 WP_003092916.1.37208 WP_003092916.1.37319 WP_003092916.1.37366 WP_003092916.1.37416 WP_003092916.1.3742 WP_003092916.1.37500 WP_003092916.1.37698 WP_003092916.1.37703 WP_003092916.1.3781 WP_003092916.1.37826 WP_003092916.1.3792 WP_003092916.1.38003 WP_003092916.1.38087 WP_003092916.1.38102 WP_003092916.1.38186 WP_003092916.1.3821 WP_003092916.1.3833 WP_003092916.1.38335 WP_003092916.1.38337 WP_003092916.1.38406 WP_003092916.1.38430 WP_003092916.1.38450 WP_003092916.1.38502 WP_003092916.1.38505 WP_003092916.1.38657 WP_003092916.1.38727 WP_003092916.1.38834 WP_003092916.1.3887 WP_003092916.1.38932 WP_003092916.1.38971 WP_003092916.1.39046 WP_003092916.1.39088 WP_003092916.1.39122 WP_003092916.1.39345 WP_003092916.1.39452 WP_003092916.1.39458 WP_003092916.1.39537 WP_003092916.1.39704 WP_003092916.1.39811 WP_003092916.1.39920 WP_003092916.1.39989 WP_003092916.1.40059 WP_003092916.1.40135 WP_003092916.1.40207 WP_003092916.1.40213 WP_003092916.1.40237 WP_003092916.1.40271 WP_003092916.1.40419 WP_003092916.1.40513 WP_003092916.1.40546 WP_003092916.1.4058 WP_003092916.1.40595 WP_003092916.1.40703 WP_003092916.1.40874 WP_003092916.1.40950 WP_003092916.1.40994 WP_003092916.1.41137 WP_003092916.1.41199 WP_003092916.1.41384 WP_003092916.1.41502 WP_003092916.1.4156 WP_003092916.1.41625 WP_003092916.1.41725 WP_003092916.1.41748 WP_003092916.1.41773 WP_003092916.1.41846 WP_003092916.1.41871 WP_003092916.1.41939 WP_003092916.1.4196 WP_003092916.1.42 WP_003092916.1.42041 WP_003092916.1.42294 WP_003092916.1.42388 WP_003092916.1.42411 WP_003092916.1.42463 WP_003092916.1.42508 WP_003092916.1.42634 WP_003092916.1.42643 WP_003092916.1.42690 WP_003092916.1.42696 WP_003092916.1.42723 WP_003092916.1.4273 WP_003092916.1.42754 WP_003092916.1.42778 WP_003092916.1.42789 WP_003092916.1.42854 WP_003092916.1.42856 WP_003092916.1.42917 WP_003092916.1.42952 WP_003092916.1.42973 WP_003092916.1.43022 WP_003092916.1.43024 WP_003092916.1.43026 WP_003092916.1.43106 WP_003092916.1.43107 WP_003092916.1.43212 WP_003092916.1.43315 WP_003092916.1.43326 WP_003092916.1.43330 WP_003092916.1.43356 WP_003092916.1.4348 WP_003092916.1.43593 WP_003092916.1.43603 WP_003092916.1.43662 WP_003092916.1.43667 WP_003092916.1.43783 WP_003092916.1.43802 WP_003092916.1.4381 WP_003092916.1.43811 WP_003092916.1.44046 WP_003092916.1.44094 WP_003092916.1.44213 WP_003092916.1.44269 WP_003092916.1.44373 WP_003092916.1.445 WP_003092916.1.44552 WP_003092916.1.44563 WP_003092916.1.44565 WP_003092916.1.44739 WP_003092916.1.44760 WP_003092916.1.44804 WP_003092916.1.44870 WP_003092916.1.4493 WP_003092916.1.44959 WP_003092916.1.45063 WP_003092916.1.45090 WP_003092916.1.45199 WP_003092916.1.45202 WP_003092916.1.4522 WP_003092916.1.45228 WP_003092916.1.45306 WP_003092916.1.45312 WP_003092916.1.4532 WP_003092916.1.45328 WP_003092916.1.45353 WP_003092916.1.45358 WP_003092916.1.45478 WP_003092916.1.45485 WP_003092916.1.45611 WP_003092916.1.45635 WP_003092916.1.45678 WP_003092916.1.45711 WP_003092916.1.45723 WP_003092916.1.45818 WP_003092916.1.45837 WP_003092916.1.45920 WP_003092916.1.45934 WP_003092916.1.45946 WP_003092916.1.45961 WP_003092916.1.46032 WP_003092916.1.46093 WP_003092916.1.46152 WP_003092916.1.4640 WP_003092916.1.46436 WP_003092916.1.46502 WP_003092916.1.46623 WP_003092916.1.46633 WP_003092916.1.46826 WP_003092916.1.46866 WP_003092916.1.46885 WP_003092916.1.46935 WP_003092916.1.47150 WP_003092916.1.47251 WP_003092916.1.4726 WP_003092916.1.47296 WP_003092916.1.47312 WP_003092916.1.47374 WP_003092916.1.47469 WP_003092916.1.47480 WP_003092916.1.47551 WP_003092916.1.47774 WP_003092916.1.47930 WP_003092916.1.47934 WP_003092916.1.48141 WP_003092916.1.48172 WP_003092916.1.48178 WP_003092916.1.48321 WP_003092916.1.48334 WP_003092916.1.4836 WP_003092916.1.48382 WP_003092916.1.48413 WP_003092916.1.48579 WP_003092916.1.48810 WP_003092916.1.48840 WP_003092916.1.48870 WP_003092916.1.48961 WP_003092916.1.4913 WP_003092916.1.49135 WP_003092916.1.49184 WP_003092916.1.49244 WP_003092916.1.49266 WP_003092916.1.49277 WP_003092916.1.49286 WP_003092916.1.49293 WP_003092916.1.49360 WP_003092916.1.49416 WP_003092916.1.49833 WP_003092916.1.49842 WP_003092916.1.49988 WP_003092916.1.50180 WP_003092916.1.50242 WP_003092916.1.50450 WP_003092916.1.50567 WP_003092916.1.50653 WP_003092916.1.50665 WP_003092916.1.50668 WP_003092916.1.50682 WP_003092916.1.50734 WP_003092916.1.50922 WP_003092916.1.50967 WP_003092916.1.50989 WP_003092916.1.51141 WP_003092916.1.51183 WP_003092916.1.51185 WP_003092916.1.51267 WP_003092916.1.5132 WP_003092916.1.51457 WP_003092916.1.51501 WP_003092916.1.51538 WP_003092916.1.51585 WP_003092916.1.51847 WP_003092916.1.51889 WP_003092916.1.51928 WP_003092916.1.51937 WP_003092916.1.51943 WP_003092916.1.51976 WP_003092916.1.52146 WP_003092916.1.52152 WP_003092916.1.52244 WP_003092916.1.52326 WP_003092916.1.52334 WP_003092916.1.5235 WP_003092916.1.52355 WP_003092916.1.52372 WP_003092916.1.52403 WP_003092916.1.52449 WP_003092916.1.52591 WP_003092916.1.5260 WP_003092916.1.52690 WP_003092916.1.52728 WP_003092916.1.52810 WP_003092916.1.5289 WP_003092916.1.52939 WP_003092916.1.5294 WP_003092916.1.53070 WP_003092916.1.53169 WP_003092916.1.53287 WP_003092916.1.53351 WP_003092916.1.53371 WP_003092916.1.53486 WP_003092916.1.53528 WP_003092916.1.53530 WP_003092916.1.53586 WP_003092916.1.53663 WP_003092916.1.53719 WP_003092916.1.53726 WP_003092916.1.53826 WP_003092916.1.5388 WP_003092916.1.53946 WP_003092916.1.53948 WP_003092916.1.53951 WP_003092916.1.5399 WP_003092916.1.54076 WP_003092916.1.54090 WP_003092916.1.54133 WP_003092916.1.54146 WP_003092916.1.5420 WP_003092916.1.54248 WP_003092916.1.5427 WP_003092916.1.54354 WP_003092916.1.54462 WP_003092916.1.54497 WP_003092916.1.54571 WP_003092916.1.54974 WP_003092916.1.55 WP_003092916.1.55347 WP_003092916.1.55400 WP_003092916.1.55478 WP_003092916.1.55976 WP_003092916.1.56013 WP_003092916.1.56145 WP_003092916.1.56171 WP_003092916.1.56187 WP_003092916.1.56188 WP_003092916.1.56196 WP_003092916.1.56229 WP_003092916.1.56348 WP_003092916.1.56442 WP_003092916.1.56474 WP_003092916.1.56475 WP_003092916.1.56623 WP_003092916.1.56632 WP_003092916.1.56745 WP_003092916.1.56768 WP_003092916.1.56797 WP_003092916.1.56837 WP_003092916.1.57065 WP_003092916.1.57113 WP_003092916.1.57131 WP_003092916.1.57140 WP_003092916.1.5731 WP_003092916.1.57460 WP_003092916.1.57480 WP_003092916.1.57532 WP_003092916.1.57548 WP_003092916.1.57566 WP_003092916.1.57728 WP_003092916.1.57839 WP_003092916.1.57921 WP_003092916.1.58019 WP_003092916.1.58056 WP_003092916.1.58162 WP_003092916.1.58228 WP_003092916.1.58294 WP_003092916.1.58436 WP_003092916.1.58581 WP_003092916.1.58689 WP_003092916.1.5869 WP_003092916.1.58785 WP_003092916.1.5889 WP_003092916.1.5897 WP_003092916.1.59013 WP_003092916.1.59076 WP_003092916.1.59099 WP_003092916.1.59156 WP_003092916.1.59176 WP_003092916.1.59246 WP_003092916.1.59249 WP_003092916.1.59288 WP_003092916.1.59339 WP_003092916.1.5937 WP_003092916.1.59385 WP_003092916.1.594 WP_003092916.1.59469 WP_003092916.1.59688 WP_003092916.1.59724 WP_003092916.1.59759 WP_003092916.1.59797 WP_003092916.1.59831 WP_003092916.1.59870 WP_003092916.1.59943 WP_003092916.1.60051 WP_003092916.1.60079 WP_003092916.1.60082 WP_003092916.1.60085 WP_003092916.1.60206 WP_003092916.1.60261 WP_003092916.1.60347 WP_003092916.1.60415 WP_003092916.1.60603 WP_003092916.1.60639 WP_003092916.1.60679 WP_003092916.1.607 WP_003092916.1.60850 WP_003092916.1.60910 WP_003092916.1.61191 WP_003092916.1.61222 WP_003092916.1.61269 WP_003092916.1.61288 WP_003092916.1.61299 WP_003092916.1.61366 WP_003092916.1.61431 WP_003092916.1.61493 WP_003092916.1.61549 WP_003092916.1.61589 WP_003092916.1.616 WP_003092916.1.61696 WP_003092916.1.6173 WP_003092916.1.61943 WP_003092916.1.62035 WP_003092916.1.62186 WP_003092916.1.62211 WP_003092916.1.62357 WP_003092916.1.62396 WP_003092916.1.62410 WP_003092916.1.62516 WP_003092916.1.62534 WP_003092916.1.62635 WP_003092916.1.62688 WP_003092916.1.62701 WP_003092916.1.62716 WP_003092916.1.62917 WP_003092916.1.62961 WP_003092916.1.63041 WP_003092916.1.63124 WP_003092916.1.63193 WP_003092916.1.63338 WP_003092916.1.63369 WP_003092916.1.63634 WP_003092916.1.63659 WP_003092916.1.63784 WP_003092916.1.63929 WP_003092916.1.63941 WP_003092916.1.63995 WP_003092916.1.64139 WP_003092916.1.64155 WP_003092916.1.64329 WP_003092916.1.64433 WP_003092916.1.64591 WP_003092916.1.64603 WP_003092916.1.64605 WP_003092916.1.64611 WP_003092916.1.64748 WP_003092916.1.64854 WP_003092916.1.64880 WP_003092916.1.64885 WP_003092916.1.64983 WP_003092916.1.65066 WP_003092916.1.65092 WP_003092916.1.65099 WP_003092916.1.65196 WP_003092916.1.65197 WP_003092916.1.65247 WP_003092916.1.65285 WP_003092916.1.65316 WP_003092916.1.65334 WP_003092916.1.65335 WP_003092916.1.65478 WP_003092916.1.65549 WP_003092916.1.65588 WP_003092916.1.65679 WP_003092916.1.65740 WP_003092916.1.65867 WP_003092916.1.6589 WP_003092916.1.66062 WP_003092916.1.66088 WP_003092916.1.66165 WP_003092916.1.6627 WP_003092916.1.66345 WP_003092916.1.66348 WP_003092916.1.66526 WP_003092916.1.66563 WP_003092916.1.66634 WP_003092916.1.66693 WP_003092916.1.66721 WP_003092916.1.66892 WP_003092916.1.66931 WP_003092916.1.66945 WP_003092916.1.67010 WP_003092916.1.67124 WP_003092916.1.67188 WP_003092916.1.67192 WP_003092916.1.67269 WP_003092916.1.6734 WP_003092916.1.67388 WP_003092916.1.67531 WP_003092916.1.67545 WP_003092916.1.6768 WP_003092916.1.67686 WP_003092916.1.67755 WP_003092916.1.67874 WP_003092916.1.67948 WP_003092916.1.6796 WP_003092916.1.68000 WP_003092916.1.6808 WP_003092916.1.68317 WP_003092916.1.68446 WP_003092916.1.68448 WP_003092916.1.68472 WP_003092916.1.68561 WP_003092916.1.68568 WP_003092916.1.68638 WP_003092916.1.6866 WP_003092916.1.68781 WP_003092916.1.68790 WP_003092916.1.68800 WP_003092916.1.68857 WP_003092916.1.68862 WP_003092916.1.68881 WP_003092916.1.68910 WP_003092916.1.69088 WP_003092916.1.6911 WP_003092916.1.69209 WP_003092916.1.6928 WP_003092916.1.6931 WP_003092916.1.6937 WP_003092916.1.69534 WP_003092916.1.69556 WP_003092916.1.69788 WP_003092916.1.69791 WP_003092916.1.69819 WP_003092916.1.69834 WP_003092916.1.70092 WP_003092916.1.70098 WP_003092916.1.70138 WP_003092916.1.70168 WP_003092916.1.70194 WP_003092916.1.70216 WP_003092916.1.70229 WP_003092916.1.70460 WP_003092916.1.70470 WP_003092916.1.70648 WP_003092916.1.70650 WP_003092916.1.70670 WP_003092916.1.70677 WP_003092916.1.70693 WP_003092916.1.70831 WP_003092916.1.70991 WP_003092916.1.71203 WP_003092916.1.71234 WP_003092916.1.71254 WP_003092916.1.71290 WP_003092916.1.71346 WP_003092916.1.71412 WP_003092916.1.71610 WP_003092916.1.71642 WP_003092916.1.71666 WP_003092916.1.71799 WP_003092916.1.71806 WP_003092916.1.71866 WP_003092916.1.71891 WP_003092916.1.72149 WP_003092916.1.72181 WP_003092916.1.72183 WP_003092916.1.7219 WP_003092916.1.72331 WP_003092916.1.72346 WP_003092916.1.72378 WP_003092916.1.72447 WP_003092916.1.72477 WP_003092916.1.72562 WP_003092916.1.72570 WP_003092916.1.72653 WP_003092916.1.72662 WP_003092916.1.72669 WP_003092916.1.72782 WP_003092916.1.72845 WP_003092916.1.73035 WP_003092916.1.73135 WP_003092916.1.73149 WP_003092916.1.73172 WP_003092916.1.7329 WP_003092916.1.733 WP_003092916.1.73455 WP_003092916.1.73523 WP_003092916.1.73651 WP_003092916.1.73860 WP_003092916.1.73941 WP_003092916.1.74 WP_003092916.1.74000 WP_003092916.1.74072 WP_003092916.1.74074 WP_003092916.1.7408 WP_003092916.1.74106 WP_003092916.1.74180 WP_003092916.1.74264 WP_003092916.1.74268 WP_003092916.1.7445 WP_003092916.1.74475 WP_003092916.1.74518 WP_003092916.1.7456 WP_003092916.1.74604 WP_003092916.1.74629 WP_003092916.1.74772 WP_003092916.1.74776 WP_003092916.1.74941 WP_003092916.1.74948 WP_003092916.1.7501 WP_003092916.1.75041 WP_003092916.1.75204 WP_003092916.1.75277 WP_003092916.1.75389 WP_003092916.1.7547 WP_003092916.1.75599 WP_003092916.1.75631 WP_003092916.1.7568 WP_003092916.1.75756 WP_003092916.1.75771 WP_003092916.1.75792 WP_003092916.1.75825 WP_003092916.1.75826 WP_003092916.1.75860 WP_003092916.1.75935 WP_003092916.1.75947 WP_003092916.1.76092 WP_003092916.1.76145 WP_003092916.1.76192 WP_003092916.1.76322 WP_003092916.1.76383 WP_003092916.1.76441 WP_003092916.1.76467 WP_003092916.1.76484 WP_003092916.1.76633 WP_003092916.1.7666 WP_003092916.1.76791 WP_003092916.1.76861 WP_003092916.1.76922 WP_003092916.1.76985 WP_003092916.1.77286 WP_003092916.1.77442 WP_003092916.1.77476 WP_003092916.1.77566 WP_003092916.1.77686 WP_003092916.1.7779 WP_003092916.1.77819 WP_003092916.1.77834 WP_003092916.1.77913 WP_003092916.1.78134 WP_003092916.1.78158 WP_003092916.1.78380 WP_003092916.1.78409 WP_003092916.1.78425 WP_003092916.1.78430 WP_003092916.1.78437 WP_003092916.1.78599 WP_003092916.1.78669 WP_003092916.1.78693 WP_003092916.1.78795 WP_003092916.1.78810 WP_003092916.1.78926 WP_003092916.1.78947 WP_003092916.1.78954 WP_003092916.1.7899 WP_003092916.1.79003 WP_003092916.1.79053 WP_003092916.1.79060 WP_003092916.1.79177 WP_003092916.1.79193 WP_003092916.1.79256 WP_003092916.1.79279 WP_003092916.1.79286 WP_003092916.1.79357 WP_003092916.1.79364 WP_003092916.1.79429 WP_003092916.1.79431 WP_003092916.1.7945 WP_003092916.1.79463 WP_003092916.1.79507 WP_003092916.1.79631 WP_003092916.1.79699 WP_003092916.1.79908 WP_003092916.1.79986 WP_003092916.1.80033 WP_003092916.1.80068 WP_003092916.1.8013 WP_003092916.1.80174 WP_003092916.1.80258 WP_003092916.1.8028 WP_003092916.1.80306 WP_003092916.1.80411 WP_003092916.1.80481 WP_003092916.1.8051 WP_003092916.1.80535 WP_003092916.1.80572 WP_003092916.1.80627 WP_003092916.1.80644 WP_003092916.1.80645 WP_003092916.1.80715 WP_003092916.1.80720 WP_003092916.1.80846 WP_003092916.1.80880 WP_003092916.1.80926 WP_003092916.1.80929 WP_003092916.1.80931 WP_003092916.1.80938 WP_003092916.1.80969 WP_003092916.1.81082 WP_003092916.1.8110 WP_003092916.1.81206 WP_003092916.1.81237 WP_003092916.1.81331 WP_003092916.1.81338 WP_003092916.1.81349 WP_003092916.1.8141 WP_003092916.1.81482 WP_003092916.1.81487 WP_003092916.1.81581 WP_003092916.1.81643 WP_003092916.1.81728 WP_003092916.1.81742 WP_003092916.1.81748 WP_003092916.1.81771 WP_003092916.1.81784 WP_003092916.1.81802 WP_003092916.1.81834 WP_003092916.1.81957 WP_003092916.1.81960 WP_003092916.1.81986 WP_003092916.1.82127 WP_003092916.1.82178 WP_003092916.1.8227 WP_003092916.1.82328 WP_003092916.1.82334 WP_003092916.1.8238 WP_003092916.1.82487 WP_003092916.1.82580 WP_003092916.1.82604 WP_003092916.1.82606 WP_003092916.1.82620 WP_003092916.1.82643 WP_003092916.1.82686 WP_003092916.1.82710 WP_003092916.1.82798 WP_003092916.1.82810 WP_003092916.1.8284 WP_003092916.1.82864 WP_003092916.1.82882 WP_003092916.1.82887 WP_003092916.1.82936 WP_003092916.1.83025 WP_003092916.1.83267 WP_003092916.1.83463 WP_003092916.1.8351 WP_003092916.1.8353 WP_003092916.1.83673 WP_003092916.1.83698 WP_003092916.1.83871 WP_003092916.1.83937 WP_003092916.1.83946 WP_003092916.1.84003 WP_003092916.1.84162 WP_003092916.1.84203 WP_003092916.1.84374 WP_003092916.1.84471 WP_003092916.1.84526 WP_003092916.1.84538 WP_003092916.1.84589 WP_003092916.1.84702 WP_003092916.1.84715 WP_003092916.1.84754 WP_003092916.1.84792 WP_003092916.1.84825 WP_003092916.1.8484 WP_003092916.1.84865 WP_003092916.1.84937 WP_003092916.1.84946 WP_003092916.1.8498 WP_003092916.1.85018 WP_003092916.1.85220 WP_003092916.1.85290 WP_003092916.1.85298 WP_003092916.1.85303 WP_003092916.1.85311 WP_003092916.1.85357 WP_003092916.1.85446 WP_003092916.1.85574 WP_003092916.1.85633 WP_003092916.1.85788 WP_003092916.1.85978 WP_003092916.1.86047 WP_003092916.1.86125 WP_003092916.1.86243 WP_003092916.1.86287 WP_003092916.1.86293 WP_003092916.1.8645 WP_003092916.1.865 WP_003092916.1.86506 WP_003092916.1.86545 WP_003092916.1.86554 WP_003092916.1.86595 WP_003092916.1.86652 WP_003092916.1.86708 WP_003092916.1.86733 WP_003092916.1.86774 WP_003092916.1.86780 WP_003092916.1.86785 WP_003092916.1.86822 WP_003092916.1.8693 WP_003092916.1.87104 WP_003092916.1.87163 WP_003092916.1.87182 WP_003092916.1.87183 WP_003092916.1.8727 WP_003092916.1.87316 WP_003092916.1.87390 WP_003092916.1.87435 WP_003092916.1.87463 WP_003092916.1.8749 WP_003092916.1.87547 WP_003092916.1.87648 WP_003092916.1.87763 WP_003092916.1.87970 WP_003092916.1.87975 WP_003092916.1.87981 WP_003092916.1.88308 WP_003092916.1.88330 WP_003092916.1.88360 WP_003092916.1.88550 WP_003092916.1.88578 WP_003092916.1.88659 WP_003092916.1.88750 WP_003092916.1.88900 WP_003092916.1.88949 WP_003092916.1.88969 WP_003092916.1.89083 WP_003092916.1.89098 WP_003092916.1.89234 WP_003092916.1.89245 WP_003092916.1.89266 WP_003092916.1.89276 WP_003092916.1.89330 WP_003092916.1.89409 WP_003092916.1.89434 WP_003092916.1.89440 WP_003092916.1.8949 WP_003092916.1.89491 WP_003092916.1.89669 WP_003092916.1.8976 WP_003092916.1.89776 WP_003092916.1.89868 WP_003092916.1.90024 WP_003092916.1.90056 WP_003092916.1.90110 WP_003092916.1.90141 WP_003092916.1.90150 WP_003092916.1.90224 WP_003092916.1.90225 WP_003092916.1.90268 WP_003092916.1.90272 WP_003092916.1.9056 WP_003092916.1.90770 WP_003092916.1.90999 WP_003092916.1.91012 WP_003092916.1.91093 WP_003092916.1.91161 WP_003092916.1.91204 WP_003092916.1.91236 WP_003092916.1.91307 WP_003092916.1.91336 WP_003092916.1.91360 WP_003092916.1.91416 WP_003092916.1.91431 WP_003092916.1.91438 WP_003092916.1.91467 WP_003092916.1.91585 WP_003092916.1.91796 WP_003092916.1.91803 WP_003092916.1.9182 WP_003092916.1.91838 WP_003092916.1.91846 WP_003092916.1.91860 WP_003092916.1.91862 WP_003092916.1.91882 WP_003092916.1.9191 WP_003092916.1.91943 WP_003092916.1.92043 WP_003092916.1.92175 WP_003092916.1.9219 WP_003092916.1.92314 WP_003092916.1.92321 WP_003092916.1.92357 WP_003092916.1.92454 WP_003092916.1.92585 WP_003092916.1.92624 WP_003092916.1.92642 WP_003092916.1.9272 WP_003092916.1.92759 WP_003092916.1.92769 WP_003092916.1.92839 WP_003092916.1.92847 WP_003092916.1.92930 WP_003092916.1.93001 WP_003092916.1.93130 WP_003092916.1.93144 WP_003092916.1.93148 WP_003092916.1.93196 WP_003092916.1.93250 WP_003092916.1.93446 WP_003092916.1.9349 WP_003092916.1.93493 WP_003092916.1.93498 WP_003092916.1.93520 WP_003092916.1.93562 WP_003092916.1.93848 WP_003092916.1.93897 WP_003092916.1.94031 WP_003092916.1.94174 WP_003092916.1.94211 WP_003092916.1.94243 WP_003092916.1.94285 WP_003092916.1.94288 WP_003092916.1.94385 WP_003092916.1.94434 WP_003092916.1.9444 WP_003092916.1.94742 WP_003092916.1.94814 WP_003092916.1.94818 WP_003092916.1.94874 WP_003092916.1.94881 WP_003092916.1.94896 WP_003092916.1.94897 WP_003092916.1.95056 WP_003092916.1.95132 WP_003092916.1.95207 WP_003092916.1.95217 WP_003092916.1.95305 WP_003092916.1.95324 WP_003092916.1.95354 WP_003092916.1.95359 WP_003092916.1.95460 WP_003092916.1.95488 WP_003092916.1.95536 WP_003092916.1.95638 WP_003092916.1.95668 WP_003092916.1.95774 WP_003092916.1.95802 WP_003092916.1.95994 WP_003092916.1.95999 WP_003092916.1.96008 WP_003092916.1.9604 WP_003092916.1.96041 WP_003092916.1.96357 WP_003092916.1.96384 WP_003092916.1.96434 WP_003092916.1.96452 WP_003092916.1.96506 WP_003092916.1.96667 WP_003092916.1.96702 WP_003092916.1.96714 WP_003092916.1.96863 WP_003092916.1.96880 WP_003092916.1.96967 WP_003092916.1.9706 WP_003092916.1.9722 WP_003092916.1.97272 WP_003092916.1.97377 WP_003092916.1.97488 WP_003092916.1.97503 WP_003092916.1.97521 WP_003092916.1.97583 WP_003092916.1.977 WP_003092916.1.97784 WP_003092916.1.97826 WP_003092916.1.98276 WP_003092916.1.98308 WP_003092916.1.98433 WP_003092916.1.98515 WP_003092916.1.98573 WP_003092916.1.98600 WP_003092916.1.98678 WP_003092916.1.98693 WP_003092916.1.98788 WP_003092916.1.9885 WP_003092916.1.98907 WP_003092916.1.98926 WP_003092916.1.99103 WP_003092916.1.99214 WP_003092916.1.99293 WP_003092916.1.99353 WP_003092916.1.99386 WP_003092916.1.99389 WP_003092916.1.99461 WP_003092916.1.9951 WP_003092916.1.99516 WP_003092916.1.99647 WP_003092916.1.99662 WP_003092916.1.99746 WP_003092916.1.99757 WP_003092916.1.99835 WP_003092916.1.9989 WP_003092916.1.99930 gi|15599047|ref|NP_252541.1| gi|514411046|ref|YP_008134481.1| gi|558674034|ref|YP_008810742.1| gi|386067944|ref|YP_005983248.1| gi|392982419|ref|YP_006481006.1| gi|558667683|ref|YP_008804393.1| gi|218889864|ref|YP_002438728.1| gi|386057153|ref|YP_005973675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]