SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152270|ref|YP_008941218.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152270|ref|YP_008941218.1|
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 69-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000767
Family Glutathione S-transferase (GST), C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568152270|ref|YP_008941218.1|
Sequence length 203
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MQLIGMLDSPFVRRVAIALRLLDLPYEHRPLSVFRNFQAFSLFNPMVKAPTLVLDDGTVL
MDSSLILDYLECLAGRERSLLPQRPQARARALSLIGAALVACEKSVQIYYELNLRPEERR
HGPWLERVEGQLLAAYDWLEAALRQEPLARDGGIELVGVTVAVAWRFSQLVVAERVAASE
YPELASYSDYAEGLPVFLETPPV
Download sequence
Identical sequences A0A072ZPL3 A0A1E9CHC1 A0A1G5LI53 A0A1S1BTW4 Q9HXG2
gi|386057161|ref|YP_005973683.1| gi|15599039|ref|NP_252533.1| 208964.PA3844 557722.PLES_11301 gi|514411039|ref|YP_008134474.1| gi|568152270|ref|YP_008941218.1| NP_252533.1.87394 WP_003113789.1.100071 WP_003113789.1.100100 WP_003113789.1.100276 WP_003113789.1.100420 WP_003113789.1.100456 WP_003113789.1.100523 WP_003113789.1.100742 WP_003113789.1.100808 WP_003113789.1.100810 WP_003113789.1.100983 WP_003113789.1.100995 WP_003113789.1.101090 WP_003113789.1.101340 WP_003113789.1.101506 WP_003113789.1.101642 WP_003113789.1.101712 WP_003113789.1.101809 WP_003113789.1.101819 WP_003113789.1.10185 WP_003113789.1.101871 WP_003113789.1.10201 WP_003113789.1.10202 WP_003113789.1.10204 WP_003113789.1.102045 WP_003113789.1.10228 WP_003113789.1.10257 WP_003113789.1.1037 WP_003113789.1.10419 WP_003113789.1.10457 WP_003113789.1.10482 WP_003113789.1.10513 WP_003113789.1.10529 WP_003113789.1.10572 WP_003113789.1.10636 WP_003113789.1.10641 WP_003113789.1.10684 WP_003113789.1.10856 WP_003113789.1.11026 WP_003113789.1.11058 WP_003113789.1.1107 WP_003113789.1.11077 WP_003113789.1.1109 WP_003113789.1.11163 WP_003113789.1.11410 WP_003113789.1.11417 WP_003113789.1.11454 WP_003113789.1.11569 WP_003113789.1.11653 WP_003113789.1.11744 WP_003113789.1.1180 WP_003113789.1.11847 WP_003113789.1.1187 WP_003113789.1.11943 WP_003113789.1.12018 WP_003113789.1.12208 WP_003113789.1.12240 WP_003113789.1.12354 WP_003113789.1.1238 WP_003113789.1.12482 WP_003113789.1.12530 WP_003113789.1.12670 WP_003113789.1.12687 WP_003113789.1.12797 WP_003113789.1.12838 WP_003113789.1.12873 WP_003113789.1.12891 WP_003113789.1.12922 WP_003113789.1.12970 WP_003113789.1.12980 WP_003113789.1.13 WP_003113789.1.1305 WP_003113789.1.13057 WP_003113789.1.13232 WP_003113789.1.13315 WP_003113789.1.1333 WP_003113789.1.13407 WP_003113789.1.13529 WP_003113789.1.1356 WP_003113789.1.1362 WP_003113789.1.13622 WP_003113789.1.13765 WP_003113789.1.13795 WP_003113789.1.13828 WP_003113789.1.14096 WP_003113789.1.14204 WP_003113789.1.14424 WP_003113789.1.14564 WP_003113789.1.14714 WP_003113789.1.1475 WP_003113789.1.14797 WP_003113789.1.14820 WP_003113789.1.14839 WP_003113789.1.14966 WP_003113789.1.15004 WP_003113789.1.152 WP_003113789.1.15222 WP_003113789.1.15373 WP_003113789.1.15379 WP_003113789.1.15474 WP_003113789.1.15480 WP_003113789.1.15482 WP_003113789.1.15485 WP_003113789.1.15692 WP_003113789.1.15889 WP_003113789.1.16041 WP_003113789.1.16109 WP_003113789.1.16142 WP_003113789.1.16161 WP_003113789.1.162 WP_003113789.1.16239 WP_003113789.1.16694 WP_003113789.1.1670 WP_003113789.1.1671 WP_003113789.1.16788 WP_003113789.1.16801 WP_003113789.1.16808 WP_003113789.1.16895 WP_003113789.1.17162 WP_003113789.1.17353 WP_003113789.1.17370 WP_003113789.1.1739 WP_003113789.1.17566 WP_003113789.1.17697 WP_003113789.1.17883 WP_003113789.1.17890 WP_003113789.1.18052 WP_003113789.1.18117 WP_003113789.1.18199 WP_003113789.1.1824 WP_003113789.1.18653 WP_003113789.1.190 WP_003113789.1.19260 WP_003113789.1.19269 WP_003113789.1.19376 WP_003113789.1.19552 WP_003113789.1.1971 WP_003113789.1.19711 WP_003113789.1.19771 WP_003113789.1.19931 WP_003113789.1.20125 WP_003113789.1.20134 WP_003113789.1.20342 WP_003113789.1.20744 WP_003113789.1.20764 WP_003113789.1.20854 WP_003113789.1.20884 WP_003113789.1.209 WP_003113789.1.21242 WP_003113789.1.21349 WP_003113789.1.21358 WP_003113789.1.21448 WP_003113789.1.21471 WP_003113789.1.21517 WP_003113789.1.21607 WP_003113789.1.2172 WP_003113789.1.21744 WP_003113789.1.21767 WP_003113789.1.21801 WP_003113789.1.21932 WP_003113789.1.22078 WP_003113789.1.2228 WP_003113789.1.22324 WP_003113789.1.22389 WP_003113789.1.22394 WP_003113789.1.22442 WP_003113789.1.22491 WP_003113789.1.22704 WP_003113789.1.22729 WP_003113789.1.22863 WP_003113789.1.2289 WP_003113789.1.22891 WP_003113789.1.23191 WP_003113789.1.23195 WP_003113789.1.2323 WP_003113789.1.23331 WP_003113789.1.23512 WP_003113789.1.23523 WP_003113789.1.23525 WP_003113789.1.23559 WP_003113789.1.23581 WP_003113789.1.23641 WP_003113789.1.23715 WP_003113789.1.23769 WP_003113789.1.23794 WP_003113789.1.23961 WP_003113789.1.23967 WP_003113789.1.24066 WP_003113789.1.24077 WP_003113789.1.24351 WP_003113789.1.24447 WP_003113789.1.24851 WP_003113789.1.24862 WP_003113789.1.24869 WP_003113789.1.24879 WP_003113789.1.25052 WP_003113789.1.25075 WP_003113789.1.251 WP_003113789.1.2511 WP_003113789.1.25142 WP_003113789.1.25149 WP_003113789.1.25179 WP_003113789.1.25348 WP_003113789.1.2535 WP_003113789.1.25532 WP_003113789.1.25695 WP_003113789.1.2572 WP_003113789.1.25964 WP_003113789.1.26025 WP_003113789.1.26042 WP_003113789.1.261 WP_003113789.1.26159 WP_003113789.1.26428 WP_003113789.1.26463 WP_003113789.1.26489 WP_003113789.1.26539 WP_003113789.1.26740 WP_003113789.1.26841 WP_003113789.1.26906 WP_003113789.1.27018 WP_003113789.1.27028 WP_003113789.1.27218 WP_003113789.1.27505 WP_003113789.1.27534 WP_003113789.1.27575 WP_003113789.1.27587 WP_003113789.1.27687 WP_003113789.1.27738 WP_003113789.1.27783 WP_003113789.1.27825 WP_003113789.1.27837 WP_003113789.1.27858 WP_003113789.1.27966 WP_003113789.1.28006 WP_003113789.1.28057 WP_003113789.1.28136 WP_003113789.1.28175 WP_003113789.1.28316 WP_003113789.1.28329 WP_003113789.1.28383 WP_003113789.1.28404 WP_003113789.1.28468 WP_003113789.1.28528 WP_003113789.1.28560 WP_003113789.1.28602 WP_003113789.1.28800 WP_003113789.1.28838 WP_003113789.1.28849 WP_003113789.1.29062 WP_003113789.1.29096 WP_003113789.1.29179 WP_003113789.1.29208 WP_003113789.1.29401 WP_003113789.1.29438 WP_003113789.1.2948 WP_003113789.1.29501 WP_003113789.1.29577 WP_003113789.1.2961 WP_003113789.1.29753 WP_003113789.1.29767 WP_003113789.1.2980 WP_003113789.1.29848 WP_003113789.1.30081 WP_003113789.1.30254 WP_003113789.1.30365 WP_003113789.1.30567 WP_003113789.1.30614 WP_003113789.1.30707 WP_003113789.1.30797 WP_003113789.1.30886 WP_003113789.1.30973 WP_003113789.1.31076 WP_003113789.1.31087 WP_003113789.1.31105 WP_003113789.1.31138 WP_003113789.1.31147 WP_003113789.1.31279 WP_003113789.1.31361 WP_003113789.1.31501 WP_003113789.1.3179 WP_003113789.1.31848 WP_003113789.1.31852 WP_003113789.1.3189 WP_003113789.1.32134 WP_003113789.1.32137 WP_003113789.1.32144 WP_003113789.1.32289 WP_003113789.1.32314 WP_003113789.1.32544 WP_003113789.1.32596 WP_003113789.1.32637 WP_003113789.1.32641 WP_003113789.1.32869 WP_003113789.1.32879 WP_003113789.1.33133 WP_003113789.1.33152 WP_003113789.1.33210 WP_003113789.1.33216 WP_003113789.1.33517 WP_003113789.1.33521 WP_003113789.1.33523 WP_003113789.1.33549 WP_003113789.1.33658 WP_003113789.1.33733 WP_003113789.1.33734 WP_003113789.1.3376 WP_003113789.1.33774 WP_003113789.1.33822 WP_003113789.1.33824 WP_003113789.1.34000 WP_003113789.1.34136 WP_003113789.1.34191 WP_003113789.1.34306 WP_003113789.1.34401 WP_003113789.1.34402 WP_003113789.1.34472 WP_003113789.1.3452 WP_003113789.1.34568 WP_003113789.1.34670 WP_003113789.1.34689 WP_003113789.1.34784 WP_003113789.1.34821 WP_003113789.1.34832 WP_003113789.1.34836 WP_003113789.1.34837 WP_003113789.1.34876 WP_003113789.1.34901 WP_003113789.1.35104 WP_003113789.1.35231 WP_003113789.1.35281 WP_003113789.1.3531 WP_003113789.1.35431 WP_003113789.1.35480 WP_003113789.1.35573 WP_003113789.1.35639 WP_003113789.1.35669 WP_003113789.1.35679 WP_003113789.1.35682 WP_003113789.1.3576 WP_003113789.1.35768 WP_003113789.1.35822 WP_003113789.1.35843 WP_003113789.1.35857 WP_003113789.1.35872 WP_003113789.1.36170 WP_003113789.1.36266 WP_003113789.1.36378 WP_003113789.1.36435 WP_003113789.1.36521 WP_003113789.1.3653 WP_003113789.1.36587 WP_003113789.1.36608 WP_003113789.1.37163 WP_003113789.1.37172 WP_003113789.1.3721 WP_003113789.1.37216 WP_003113789.1.37319 WP_003113789.1.37500 WP_003113789.1.37512 WP_003113789.1.3781 WP_003113789.1.37814 WP_003113789.1.37842 WP_003113789.1.3785 WP_003113789.1.38087 WP_003113789.1.38102 WP_003113789.1.38146 WP_003113789.1.38151 WP_003113789.1.3821 WP_003113789.1.38319 WP_003113789.1.3833 WP_003113789.1.38337 WP_003113789.1.38430 WP_003113789.1.38450 WP_003113789.1.38502 WP_003113789.1.38505 WP_003113789.1.38583 WP_003113789.1.38661 WP_003113789.1.38889 WP_003113789.1.38971 WP_003113789.1.39088 WP_003113789.1.39122 WP_003113789.1.39186 WP_003113789.1.39271 WP_003113789.1.39345 WP_003113789.1.39444 WP_003113789.1.39452 WP_003113789.1.39458 WP_003113789.1.39704 WP_003113789.1.39786 WP_003113789.1.39811 WP_003113789.1.39949 WP_003113789.1.39989 WP_003113789.1.40059 WP_003113789.1.40135 WP_003113789.1.40243 WP_003113789.1.40419 WP_003113789.1.40512 WP_003113789.1.40546 WP_003113789.1.4058 WP_003113789.1.40950 WP_003113789.1.41301 WP_003113789.1.41384 WP_003113789.1.41412 WP_003113789.1.41502 WP_003113789.1.4156 WP_003113789.1.41692 WP_003113789.1.41725 WP_003113789.1.41732 WP_003113789.1.41773 WP_003113789.1.41832 WP_003113789.1.41846 WP_003113789.1.41871 WP_003113789.1.41888 WP_003113789.1.4190 WP_003113789.1.42019 WP_003113789.1.42041 WP_003113789.1.42146 WP_003113789.1.42259 WP_003113789.1.42423 WP_003113789.1.42463 WP_003113789.1.42754 WP_003113789.1.42757 WP_003113789.1.42789 WP_003113789.1.42856 WP_003113789.1.42917 WP_003113789.1.42946 WP_003113789.1.42952 WP_003113789.1.42972 WP_003113789.1.42973 WP_003113789.1.43026 WP_003113789.1.43106 WP_003113789.1.43107 WP_003113789.1.43293 WP_003113789.1.43315 WP_003113789.1.43330 WP_003113789.1.43603 WP_003113789.1.43662 WP_003113789.1.43667 WP_003113789.1.43802 WP_003113789.1.4381 WP_003113789.1.43826 WP_003113789.1.4398 WP_003113789.1.44046 WP_003113789.1.44260 WP_003113789.1.44373 WP_003113789.1.44434 WP_003113789.1.44581 WP_003113789.1.44959 WP_003113789.1.45063 WP_003113789.1.45090 WP_003113789.1.45146 WP_003113789.1.45228 WP_003113789.1.45312 WP_003113789.1.4532 WP_003113789.1.45464 WP_003113789.1.45485 WP_003113789.1.45711 WP_003113789.1.45723 WP_003113789.1.45818 WP_003113789.1.45920 WP_003113789.1.45934 WP_003113789.1.46010 WP_003113789.1.461 WP_003113789.1.46152 WP_003113789.1.46200 WP_003113789.1.46436 WP_003113789.1.46755 WP_003113789.1.46787 WP_003113789.1.46926 WP_003113789.1.47101 WP_003113789.1.47155 WP_003113789.1.4726 WP_003113789.1.47312 WP_003113789.1.47469 WP_003113789.1.47480 WP_003113789.1.47527 WP_003113789.1.47645 WP_003113789.1.47774 WP_003113789.1.47970 WP_003113789.1.48001 WP_003113789.1.48024 WP_003113789.1.48086 WP_003113789.1.48094 WP_003113789.1.48178 WP_003113789.1.48321 WP_003113789.1.48334 WP_003113789.1.4836 WP_003113789.1.48378 WP_003113789.1.48413 WP_003113789.1.48545 WP_003113789.1.48576 WP_003113789.1.48747 WP_003113789.1.48820 WP_003113789.1.48842 WP_003113789.1.48961 WP_003113789.1.4913 WP_003113789.1.49135 WP_003113789.1.49265 WP_003113789.1.49286 WP_003113789.1.49360 WP_003113789.1.49500 WP_003113789.1.49557 WP_003113789.1.49688 WP_003113789.1.49798 WP_003113789.1.49976 WP_003113789.1.49998 WP_003113789.1.50176 WP_003113789.1.50180 WP_003113789.1.50222 WP_003113789.1.50242 WP_003113789.1.5043 WP_003113789.1.50567 WP_003113789.1.50653 WP_003113789.1.50665 WP_003113789.1.50668 WP_003113789.1.50814 WP_003113789.1.50967 WP_003113789.1.51019 WP_003113789.1.51035 WP_003113789.1.51141 WP_003113789.1.51183 WP_003113789.1.51267 WP_003113789.1.5132 WP_003113789.1.51457 WP_003113789.1.51501 WP_003113789.1.51549 WP_003113789.1.51682 WP_003113789.1.51807 WP_003113789.1.51847 WP_003113789.1.51889 WP_003113789.1.51937 WP_003113789.1.52043 WP_003113789.1.52220 WP_003113789.1.52244 WP_003113789.1.52326 WP_003113789.1.52537 WP_003113789.1.5258 WP_003113789.1.52583 WP_003113789.1.5260 WP_003113789.1.52690 WP_003113789.1.52697 WP_003113789.1.52700 WP_003113789.1.52728 WP_003113789.1.52784 WP_003113789.1.53070 WP_003113789.1.53371 WP_003113789.1.53486 WP_003113789.1.53530 WP_003113789.1.53719 WP_003113789.1.5388 WP_003113789.1.53932 WP_003113789.1.54133 WP_003113789.1.5420 WP_003113789.1.54248 WP_003113789.1.5427 WP_003113789.1.54462 WP_003113789.1.54497 WP_003113789.1.54571 WP_003113789.1.54742 WP_003113789.1.54809 WP_003113789.1.55089 WP_003113789.1.55169 WP_003113789.1.55318 WP_003113789.1.55347 WP_003113789.1.55543 WP_003113789.1.56013 WP_003113789.1.56315 WP_003113789.1.56348 WP_003113789.1.56452 WP_003113789.1.56475 WP_003113789.1.56623 WP_003113789.1.56632 WP_003113789.1.56797 WP_003113789.1.56808 WP_003113789.1.56819 WP_003113789.1.56837 WP_003113789.1.56973 WP_003113789.1.57005 WP_003113789.1.57131 WP_003113789.1.57276 WP_003113789.1.5731 WP_003113789.1.57532 WP_003113789.1.57548 WP_003113789.1.57566 WP_003113789.1.57728 WP_003113789.1.58019 WP_003113789.1.58056 WP_003113789.1.58183 WP_003113789.1.58193 WP_003113789.1.58436 WP_003113789.1.58482 WP_003113789.1.58527 WP_003113789.1.58689 WP_003113789.1.58838 WP_003113789.1.58845 WP_003113789.1.5889 WP_003113789.1.59013 WP_003113789.1.59076 WP_003113789.1.59099 WP_003113789.1.59156 WP_003113789.1.59249 WP_003113789.1.59250 WP_003113789.1.59288 WP_003113789.1.59563 WP_003113789.1.59688 WP_003113789.1.59759 WP_003113789.1.59831 WP_003113789.1.60062 WP_003113789.1.60206 WP_003113789.1.60261 WP_003113789.1.60347 WP_003113789.1.60415 WP_003113789.1.60467 WP_003113789.1.60600 WP_003113789.1.60602 WP_003113789.1.60603 WP_003113789.1.60639 WP_003113789.1.60686 WP_003113789.1.607 WP_003113789.1.60910 WP_003113789.1.60916 WP_003113789.1.61122 WP_003113789.1.61130 WP_003113789.1.61209 WP_003113789.1.6130 WP_003113789.1.61493 WP_003113789.1.61549 WP_003113789.1.61598 WP_003113789.1.61696 WP_003113789.1.6173 WP_003113789.1.61943 WP_003113789.1.62035 WP_003113789.1.62186 WP_003113789.1.62211 WP_003113789.1.62357 WP_003113789.1.6242 WP_003113789.1.62483 WP_003113789.1.62516 WP_003113789.1.62534 WP_003113789.1.62635 WP_003113789.1.62688 WP_003113789.1.62701 WP_003113789.1.62704 WP_003113789.1.62716 WP_003113789.1.62768 WP_003113789.1.62772 WP_003113789.1.62834 WP_003113789.1.62873 WP_003113789.1.62917 WP_003113789.1.63124 WP_003113789.1.63196 WP_003113789.1.63338 WP_003113789.1.63597 WP_003113789.1.63634 WP_003113789.1.63995 WP_003113789.1.64139 WP_003113789.1.64155 WP_003113789.1.64198 WP_003113789.1.64309 WP_003113789.1.64433 WP_003113789.1.64591 WP_003113789.1.64807 WP_003113789.1.64862 WP_003113789.1.64880 WP_003113789.1.64885 WP_003113789.1.64983 WP_003113789.1.64984 WP_003113789.1.65009 WP_003113789.1.65066 WP_003113789.1.65092 WP_003113789.1.65095 WP_003113789.1.65099 WP_003113789.1.65145 WP_003113789.1.65196 WP_003113789.1.65237 WP_003113789.1.65285 WP_003113789.1.65316 WP_003113789.1.65334 WP_003113789.1.65335 WP_003113789.1.65549 WP_003113789.1.65642 WP_003113789.1.65740 WP_003113789.1.65819 WP_003113789.1.65926 WP_003113789.1.66165 WP_003113789.1.66277 WP_003113789.1.6629 WP_003113789.1.66348 WP_003113789.1.66364 WP_003113789.1.66526 WP_003113789.1.66634 WP_003113789.1.66721 WP_003113789.1.66892 WP_003113789.1.66929 WP_003113789.1.66931 WP_003113789.1.66945 WP_003113789.1.66950 WP_003113789.1.67192 WP_003113789.1.67205 WP_003113789.1.67261 WP_003113789.1.67269 WP_003113789.1.67370 WP_003113789.1.67388 WP_003113789.1.67472 WP_003113789.1.67526 WP_003113789.1.67531 WP_003113789.1.67686 WP_003113789.1.67830 WP_003113789.1.68000 WP_003113789.1.68158 WP_003113789.1.68162 WP_003113789.1.68183 WP_003113789.1.68252 WP_003113789.1.68317 WP_003113789.1.68472 WP_003113789.1.6850 WP_003113789.1.68568 WP_003113789.1.68638 WP_003113789.1.68756 WP_003113789.1.68800 WP_003113789.1.68850 WP_003113789.1.68857 WP_003113789.1.68862 WP_003113789.1.68910 WP_003113789.1.68938 WP_003113789.1.69088 WP_003113789.1.69159 WP_003113789.1.69260 WP_003113789.1.6937 WP_003113789.1.69534 WP_003113789.1.69556 WP_003113789.1.69702 WP_003113789.1.69788 WP_003113789.1.69819 WP_003113789.1.69834 WP_003113789.1.69907 WP_003113789.1.69993 WP_003113789.1.70168 WP_003113789.1.70216 WP_003113789.1.70460 WP_003113789.1.70561 WP_003113789.1.70648 WP_003113789.1.70670 WP_003113789.1.70693 WP_003113789.1.7077 WP_003113789.1.70778 WP_003113789.1.71038 WP_003113789.1.7128 WP_003113789.1.71346 WP_003113789.1.71385 WP_003113789.1.71666 WP_003113789.1.71806 WP_003113789.1.71891 WP_003113789.1.72149 WP_003113789.1.72167 WP_003113789.1.72287 WP_003113789.1.72323 WP_003113789.1.72331 WP_003113789.1.72346 WP_003113789.1.72541 WP_003113789.1.72562 WP_003113789.1.72570 WP_003113789.1.72653 WP_003113789.1.7276 WP_003113789.1.72768 WP_003113789.1.72772 WP_003113789.1.73048 WP_003113789.1.7308 WP_003113789.1.73135 WP_003113789.1.73149 WP_003113789.1.7327 WP_003113789.1.73455 WP_003113789.1.73541 WP_003113789.1.73651 WP_003113789.1.73791 WP_003113789.1.7382 WP_003113789.1.73860 WP_003113789.1.73911 WP_003113789.1.73941 WP_003113789.1.74 WP_003113789.1.74000 WP_003113789.1.74072 WP_003113789.1.74074 WP_003113789.1.7408 WP_003113789.1.74167 WP_003113789.1.74182 WP_003113789.1.74219 WP_003113789.1.74264 WP_003113789.1.74268 WP_003113789.1.7445 WP_003113789.1.74458 WP_003113789.1.74473 WP_003113789.1.74475 WP_003113789.1.74568 WP_003113789.1.74776 WP_003113789.1.748 WP_003113789.1.74948 WP_003113789.1.74958 WP_003113789.1.75041 WP_003113789.1.75119 WP_003113789.1.75277 WP_003113789.1.7547 WP_003113789.1.75549 WP_003113789.1.75573 WP_003113789.1.75771 WP_003113789.1.75792 WP_003113789.1.75825 WP_003113789.1.75826 WP_003113789.1.75935 WP_003113789.1.75947 WP_003113789.1.7595 WP_003113789.1.76092 WP_003113789.1.76192 WP_003113789.1.76355 WP_003113789.1.76467 WP_003113789.1.76484 WP_003113789.1.76600 WP_003113789.1.76633 WP_003113789.1.76716 WP_003113789.1.76791 WP_003113789.1.76985 WP_003113789.1.77235 WP_003113789.1.77238 WP_003113789.1.77317 WP_003113789.1.77476 WP_003113789.1.77490 WP_003113789.1.77686 WP_003113789.1.77750 WP_003113789.1.77769 WP_003113789.1.7779 WP_003113789.1.77834 WP_003113789.1.78112 WP_003113789.1.78158 WP_003113789.1.78280 WP_003113789.1.78409 WP_003113789.1.78430 WP_003113789.1.78437 WP_003113789.1.78570 WP_003113789.1.78623 WP_003113789.1.78693 WP_003113789.1.78795 WP_003113789.1.78947 WP_003113789.1.78986 WP_003113789.1.79007 WP_003113789.1.79177 WP_003113789.1.79279 WP_003113789.1.79311 WP_003113789.1.79364 WP_003113789.1.7945 WP_003113789.1.79463 WP_003113789.1.79507 WP_003113789.1.7953 WP_003113789.1.79569 WP_003113789.1.79601 WP_003113789.1.79631 WP_003113789.1.79699 WP_003113789.1.79788 WP_003113789.1.80033 WP_003113789.1.80068 WP_003113789.1.80087 WP_003113789.1.80174 WP_003113789.1.80410 WP_003113789.1.80411 WP_003113789.1.80535 WP_003113789.1.8064 WP_003113789.1.80645 WP_003113789.1.80720 WP_003113789.1.80846 WP_003113789.1.80892 WP_003113789.1.80931 WP_003113789.1.81081 WP_003113789.1.8110 WP_003113789.1.81237 WP_003113789.1.81482 WP_003113789.1.81487 WP_003113789.1.81581 WP_003113789.1.81643 WP_003113789.1.81771 WP_003113789.1.81802 WP_003113789.1.81816 WP_003113789.1.81834 WP_003113789.1.81844 WP_003113789.1.81950 WP_003113789.1.81986 WP_003113789.1.82117 WP_003113789.1.82127 WP_003113789.1.82260 WP_003113789.1.82312 WP_003113789.1.82328 WP_003113789.1.82334 WP_003113789.1.82604 WP_003113789.1.82606 WP_003113789.1.82620 WP_003113789.1.82643 WP_003113789.1.82710 WP_003113789.1.8284 WP_003113789.1.82882 WP_003113789.1.82936 WP_003113789.1.83184 WP_003113789.1.83213 WP_003113789.1.83251 WP_003113789.1.83296 WP_003113789.1.83394 WP_003113789.1.835 WP_003113789.1.8353 WP_003113789.1.83637 WP_003113789.1.83715 WP_003113789.1.84003 WP_003113789.1.84008 WP_003113789.1.84174 WP_003113789.1.84177 WP_003113789.1.84190 WP_003113789.1.84203 WP_003113789.1.84271 WP_003113789.1.84297 WP_003113789.1.84374 WP_003113789.1.84398 WP_003113789.1.84471 WP_003113789.1.8453 WP_003113789.1.84538 WP_003113789.1.84589 WP_003113789.1.84674 WP_003113789.1.84702 WP_003113789.1.84715 WP_003113789.1.84754 WP_003113789.1.8484 WP_003113789.1.8498 WP_003113789.1.85018 WP_003113789.1.85220 WP_003113789.1.85318 WP_003113789.1.85574 WP_003113789.1.85788 WP_003113789.1.85897 WP_003113789.1.86047 WP_003113789.1.86058 WP_003113789.1.86125 WP_003113789.1.86278 WP_003113789.1.86287 WP_003113789.1.865 WP_003113789.1.86545 WP_003113789.1.86552 WP_003113789.1.86652 WP_003113789.1.86708 WP_003113789.1.86733 WP_003113789.1.86785 WP_003113789.1.86813 WP_003113789.1.86985 WP_003113789.1.87163 WP_003113789.1.8718 WP_003113789.1.87182 WP_003113789.1.8727 WP_003113789.1.87316 WP_003113789.1.87390 WP_003113789.1.87435 WP_003113789.1.87530 WP_003113789.1.87981 WP_003113789.1.88004 WP_003113789.1.88308 WP_003113789.1.88330 WP_003113789.1.88517 WP_003113789.1.88550 WP_003113789.1.88578 WP_003113789.1.88605 WP_003113789.1.88659 WP_003113789.1.88714 WP_003113789.1.88900 WP_003113789.1.88949 WP_003113789.1.89098 WP_003113789.1.8911 WP_003113789.1.89234 WP_003113789.1.89245 WP_003113789.1.89266 WP_003113789.1.89440 WP_003113789.1.8949 WP_003113789.1.89491 WP_003113789.1.89577 WP_003113789.1.89610 WP_003113789.1.89662 WP_003113789.1.89736 WP_003113789.1.8976 WP_003113789.1.89805 WP_003113789.1.89866 WP_003113789.1.89886 WP_003113789.1.90024 WP_003113789.1.90141 WP_003113789.1.90150 WP_003113789.1.90224 WP_003113789.1.90225 WP_003113789.1.90242 WP_003113789.1.90306 WP_003113789.1.90412 WP_003113789.1.90569 WP_003113789.1.90655 WP_003113789.1.90770 WP_003113789.1.91093 WP_003113789.1.9120 WP_003113789.1.91204 WP_003113789.1.91360 WP_003113789.1.9143 WP_003113789.1.91431 WP_003113789.1.91438 WP_003113789.1.91803 WP_003113789.1.9182 WP_003113789.1.91846 WP_003113789.1.91862 WP_003113789.1.9191 WP_003113789.1.91943 WP_003113789.1.92175 WP_003113789.1.92321 WP_003113789.1.92357 WP_003113789.1.92454 WP_003113789.1.92573 WP_003113789.1.92624 WP_003113789.1.92769 WP_003113789.1.92847 WP_003113789.1.92930 WP_003113789.1.93001 WP_003113789.1.93122 WP_003113789.1.93130 WP_003113789.1.93144 WP_003113789.1.93250 WP_003113789.1.9328 WP_003113789.1.93446 WP_003113789.1.93498 WP_003113789.1.93797 WP_003113789.1.93848 WP_003113789.1.93897 WP_003113789.1.94004 WP_003113789.1.94218 WP_003113789.1.94285 WP_003113789.1.94385 WP_003113789.1.94450 WP_003113789.1.94682 WP_003113789.1.94814 WP_003113789.1.94818 WP_003113789.1.94856 WP_003113789.1.94874 WP_003113789.1.94896 WP_003113789.1.94897 WP_003113789.1.95027 WP_003113789.1.95056 WP_003113789.1.95117 WP_003113789.1.95187 WP_003113789.1.95217 WP_003113789.1.95305 WP_003113789.1.95324 WP_003113789.1.95525 WP_003113789.1.95536 WP_003113789.1.95668 WP_003113789.1.95745 WP_003113789.1.95751 WP_003113789.1.95774 WP_003113789.1.95802 WP_003113789.1.95820 WP_003113789.1.95825 WP_003113789.1.9599 WP_003113789.1.95994 WP_003113789.1.95999 WP_003113789.1.96008 WP_003113789.1.9604 WP_003113789.1.96041 WP_003113789.1.96193 WP_003113789.1.96243 WP_003113789.1.96267 WP_003113789.1.96357 WP_003113789.1.96434 WP_003113789.1.96506 WP_003113789.1.96667 WP_003113789.1.96880 WP_003113789.1.9706 WP_003113789.1.97118 WP_003113789.1.97126 WP_003113789.1.97213 WP_003113789.1.9722 WP_003113789.1.97271 WP_003113789.1.97272 WP_003113789.1.97474 WP_003113789.1.97614 WP_003113789.1.97826 WP_003113789.1.97968 WP_003113789.1.98260 WP_003113789.1.98276 WP_003113789.1.98308 WP_003113789.1.98410 WP_003113789.1.98414 WP_003113789.1.98522 WP_003113789.1.98600 WP_003113789.1.98610 WP_003113789.1.98672 WP_003113789.1.98678 WP_003113789.1.98693 WP_003113789.1.9885 WP_003113789.1.98907 WP_003113789.1.99068 WP_003113789.1.99214 WP_003113789.1.99293 WP_003113789.1.99386 WP_003113789.1.99461 WP_003113789.1.9951 WP_003113789.1.99757 WP_003113789.1.99795 WP_003113789.1.9989 gi|568307892|ref|YP_008980161.1| gi|218889872|ref|YP_002438736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]