SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152273|ref|YP_008941221.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152273|ref|YP_008941221.1|
Domain Number 1 Region: 95-229
Classification Level Classification E-value
Superfamily Bacterial GAP domain 2.35e-52
Family Bacterial GAP domain 0.000000262
Further Details:      
 
Domain Number 2 Region: 233-423
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.17e-36
Family ADP-ribosylating toxins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568152273|ref|YP_008941221.1|
Sequence length 453
Comment ADP-ribosyltransferase [Pseudomonas aeruginosa LES431]
Sequence
MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAA
LVRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKA
SELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIA
LQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADG
LVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQG
MSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTIS
TVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQ
GLLDALDLASKPERSGEVQEQDVRLRMRGLDLA
Download sequence
Identical sequences A0A0H3R155 A0A1E9CFQ4 A0A1F0IB27 G3XDA1 Q51449
gi|568307896|ref|YP_008980165.1| 208964.PA3841 557722.PLES_11331 gi|558674024|ref|YP_008810732.1| gi|392982431|ref|YP_006481018.1| gi|218889875|ref|YP_002438739.1| gi|514411037|ref|YP_008134471.1| gi|15599036|ref|NP_252530.1| gi|558667673|ref|YP_008804383.1| gi|568152273|ref|YP_008941221.1| NP_252530.1.87394 WP_003113791.1.100071 WP_003113791.1.100100 WP_003113791.1.100276 WP_003113791.1.100420 WP_003113791.1.100456 WP_003113791.1.100654 WP_003113791.1.100742 WP_003113791.1.100786 WP_003113791.1.100808 WP_003113791.1.100810 WP_003113791.1.100872 WP_003113791.1.100983 WP_003113791.1.100995 WP_003113791.1.101090 WP_003113791.1.101340 WP_003113791.1.101572 WP_003113791.1.101642 WP_003113791.1.101739 WP_003113791.1.101809 WP_003113791.1.101819 WP_003113791.1.101863 WP_003113791.1.101871 WP_003113791.1.10201 WP_003113791.1.10202 WP_003113791.1.10204 WP_003113791.1.102045 WP_003113791.1.10228 WP_003113791.1.10257 WP_003113791.1.10419 WP_003113791.1.10468 WP_003113791.1.10477 WP_003113791.1.10482 WP_003113791.1.10513 WP_003113791.1.10572 WP_003113791.1.10636 WP_003113791.1.10641 WP_003113791.1.10684 WP_003113791.1.10856 WP_003113791.1.10901 WP_003113791.1.11026 WP_003113791.1.11058 WP_003113791.1.11077 WP_003113791.1.1109 WP_003113791.1.11163 WP_003113791.1.11178 WP_003113791.1.11381 WP_003113791.1.11410 WP_003113791.1.11417 WP_003113791.1.11454 WP_003113791.1.11568 WP_003113791.1.11569 WP_003113791.1.11653 WP_003113791.1.11744 WP_003113791.1.1180 WP_003113791.1.11847 WP_003113791.1.1187 WP_003113791.1.11943 WP_003113791.1.12018 WP_003113791.1.12120 WP_003113791.1.12240 WP_003113791.1.12354 WP_003113791.1.1238 WP_003113791.1.12482 WP_003113791.1.12670 WP_003113791.1.12797 WP_003113791.1.12873 WP_003113791.1.12891 WP_003113791.1.12970 WP_003113791.1.12980 WP_003113791.1.13 WP_003113791.1.1305 WP_003113791.1.13057 WP_003113791.1.13232 WP_003113791.1.13315 WP_003113791.1.1333 WP_003113791.1.13407 WP_003113791.1.1356 WP_003113791.1.1362 WP_003113791.1.13622 WP_003113791.1.13765 WP_003113791.1.13785 WP_003113791.1.13795 WP_003113791.1.13828 WP_003113791.1.14078 WP_003113791.1.14096 WP_003113791.1.14204 WP_003113791.1.14460 WP_003113791.1.14564 WP_003113791.1.14714 WP_003113791.1.1475 WP_003113791.1.14754 WP_003113791.1.14820 WP_003113791.1.14835 WP_003113791.1.14839 WP_003113791.1.14966 WP_003113791.1.15004 WP_003113791.1.152 WP_003113791.1.15222 WP_003113791.1.15281 WP_003113791.1.15373 WP_003113791.1.15379 WP_003113791.1.15474 WP_003113791.1.15480 WP_003113791.1.15482 WP_003113791.1.15485 WP_003113791.1.15692 WP_003113791.1.15934 WP_003113791.1.16041 WP_003113791.1.16109 WP_003113791.1.16142 WP_003113791.1.16161 WP_003113791.1.16197 WP_003113791.1.16267 WP_003113791.1.16419 WP_003113791.1.1646 WP_003113791.1.16694 WP_003113791.1.1670 WP_003113791.1.1671 WP_003113791.1.16782 WP_003113791.1.16788 WP_003113791.1.16801 WP_003113791.1.16808 WP_003113791.1.16895 WP_003113791.1.17022 WP_003113791.1.17162 WP_003113791.1.1739 WP_003113791.1.17566 WP_003113791.1.17697 WP_003113791.1.17883 WP_003113791.1.17890 WP_003113791.1.18199 WP_003113791.1.18204 WP_003113791.1.18234 WP_003113791.1.18493 WP_003113791.1.18547 WP_003113791.1.18653 WP_003113791.1.18728 WP_003113791.1.18769 WP_003113791.1.18892 WP_003113791.1.18930 WP_003113791.1.190 WP_003113791.1.19260 WP_003113791.1.19269 WP_003113791.1.19376 WP_003113791.1.19703 WP_003113791.1.1971 WP_003113791.1.19711 WP_003113791.1.19771 WP_003113791.1.20024 WP_003113791.1.20070 WP_003113791.1.20125 WP_003113791.1.20342 WP_003113791.1.20744 WP_003113791.1.20764 WP_003113791.1.20854 WP_003113791.1.20884 WP_003113791.1.209 WP_003113791.1.21242 WP_003113791.1.21349 WP_003113791.1.21448 WP_003113791.1.21469 WP_003113791.1.21517 WP_003113791.1.21607 WP_003113791.1.2172 WP_003113791.1.21744 WP_003113791.1.21767 WP_003113791.1.21782 WP_003113791.1.21801 WP_003113791.1.21932 WP_003113791.1.22078 WP_003113791.1.2228 WP_003113791.1.22389 WP_003113791.1.22442 WP_003113791.1.22491 WP_003113791.1.22704 WP_003113791.1.22729 WP_003113791.1.22863 WP_003113791.1.2289 WP_003113791.1.22891 WP_003113791.1.23195 WP_003113791.1.2323 WP_003113791.1.23331 WP_003113791.1.23418 WP_003113791.1.23512 WP_003113791.1.23523 WP_003113791.1.23525 WP_003113791.1.23559 WP_003113791.1.23581 WP_003113791.1.23641 WP_003113791.1.23715 WP_003113791.1.23739 WP_003113791.1.23782 WP_003113791.1.23794 WP_003113791.1.23884 WP_003113791.1.23925 WP_003113791.1.23961 WP_003113791.1.23967 WP_003113791.1.23983 WP_003113791.1.24066 WP_003113791.1.24077 WP_003113791.1.24351 WP_003113791.1.24447 WP_003113791.1.2477 WP_003113791.1.24851 WP_003113791.1.24862 WP_003113791.1.24879 WP_003113791.1.25052 WP_003113791.1.25075 WP_003113791.1.251 WP_003113791.1.2511 WP_003113791.1.25142 WP_003113791.1.25149 WP_003113791.1.25179 WP_003113791.1.25191 WP_003113791.1.2529 WP_003113791.1.25348 WP_003113791.1.2535 WP_003113791.1.25477 WP_003113791.1.25532 WP_003113791.1.2596 WP_003113791.1.25964 WP_003113791.1.26025 WP_003113791.1.26042 WP_003113791.1.261 WP_003113791.1.26159 WP_003113791.1.26301 WP_003113791.1.26334 WP_003113791.1.26428 WP_003113791.1.26463 WP_003113791.1.26489 WP_003113791.1.26539 WP_003113791.1.26604 WP_003113791.1.26682 WP_003113791.1.26841 WP_003113791.1.26906 WP_003113791.1.27018 WP_003113791.1.27028 WP_003113791.1.27218 WP_003113791.1.27505 WP_003113791.1.27534 WP_003113791.1.27575 WP_003113791.1.27587 WP_003113791.1.27738 WP_003113791.1.27783 WP_003113791.1.27837 WP_003113791.1.27858 WP_003113791.1.27966 WP_003113791.1.28006 WP_003113791.1.28057 WP_003113791.1.28064 WP_003113791.1.28175 WP_003113791.1.28316 WP_003113791.1.28329 WP_003113791.1.28383 WP_003113791.1.28468 WP_003113791.1.28528 WP_003113791.1.28602 WP_003113791.1.28623 WP_003113791.1.28800 WP_003113791.1.28823 WP_003113791.1.28838 WP_003113791.1.28849 WP_003113791.1.28920 WP_003113791.1.29096 WP_003113791.1.29179 WP_003113791.1.29208 WP_003113791.1.2927 WP_003113791.1.29401 WP_003113791.1.29438 WP_003113791.1.29472 WP_003113791.1.2948 WP_003113791.1.29498 WP_003113791.1.29501 WP_003113791.1.2961 WP_003113791.1.29753 WP_003113791.1.2980 WP_003113791.1.30254 WP_003113791.1.30475 WP_003113791.1.30567 WP_003113791.1.30707 WP_003113791.1.3072 WP_003113791.1.30797 WP_003113791.1.30886 WP_003113791.1.30973 WP_003113791.1.30994 WP_003113791.1.31076 WP_003113791.1.31087 WP_003113791.1.31103 WP_003113791.1.31105 WP_003113791.1.31138 WP_003113791.1.31147 WP_003113791.1.31279 WP_003113791.1.31361 WP_003113791.1.31501 WP_003113791.1.3179 WP_003113791.1.31852 WP_003113791.1.3189 WP_003113791.1.32134 WP_003113791.1.32137 WP_003113791.1.32144 WP_003113791.1.32314 WP_003113791.1.32544 WP_003113791.1.32596 WP_003113791.1.32637 WP_003113791.1.32641 WP_003113791.1.32711 WP_003113791.1.32869 WP_003113791.1.32879 WP_003113791.1.33133 WP_003113791.1.33152 WP_003113791.1.33186 WP_003113791.1.33204 WP_003113791.1.33210 WP_003113791.1.33216 WP_003113791.1.33387 WP_003113791.1.33455 WP_003113791.1.33517 WP_003113791.1.33521 WP_003113791.1.33523 WP_003113791.1.33549 WP_003113791.1.33658 WP_003113791.1.33733 WP_003113791.1.33734 WP_003113791.1.33774 WP_003113791.1.33824 WP_003113791.1.34000 WP_003113791.1.34136 WP_003113791.1.34151 WP_003113791.1.34191 WP_003113791.1.34306 WP_003113791.1.34401 WP_003113791.1.34402 WP_003113791.1.34472 WP_003113791.1.3452 WP_003113791.1.34568 WP_003113791.1.34670 WP_003113791.1.34689 WP_003113791.1.34784 WP_003113791.1.34821 WP_003113791.1.34832 WP_003113791.1.34836 WP_003113791.1.34901 WP_003113791.1.35104 WP_003113791.1.35281 WP_003113791.1.3531 WP_003113791.1.35480 WP_003113791.1.35599 WP_003113791.1.35639 WP_003113791.1.35641 WP_003113791.1.35679 WP_003113791.1.35682 WP_003113791.1.35768 WP_003113791.1.35822 WP_003113791.1.35843 WP_003113791.1.35857 WP_003113791.1.35872 WP_003113791.1.36170 WP_003113791.1.36266 WP_003113791.1.36378 WP_003113791.1.36435 WP_003113791.1.3653 WP_003113791.1.36587 WP_003113791.1.36608 WP_003113791.1.36630 WP_003113791.1.37097 WP_003113791.1.37163 WP_003113791.1.37208 WP_003113791.1.3721 WP_003113791.1.37216 WP_003113791.1.37500 WP_003113791.1.37512 WP_003113791.1.37814 WP_003113791.1.37818 WP_003113791.1.37826 WP_003113791.1.37842 WP_003113791.1.3785 WP_003113791.1.3792 WP_003113791.1.38087 WP_003113791.1.38102 WP_003113791.1.38146 WP_003113791.1.38151 WP_003113791.1.38186 WP_003113791.1.3821 WP_003113791.1.38319 WP_003113791.1.3833 WP_003113791.1.38337 WP_003113791.1.38430 WP_003113791.1.38450 WP_003113791.1.38502 WP_003113791.1.38583 WP_003113791.1.38657 WP_003113791.1.38661 WP_003113791.1.38706 WP_003113791.1.38889 WP_003113791.1.38971 WP_003113791.1.39046 WP_003113791.1.39088 WP_003113791.1.39122 WP_003113791.1.39186 WP_003113791.1.39271 WP_003113791.1.39345 WP_003113791.1.39444 WP_003113791.1.39452 WP_003113791.1.39704 WP_003113791.1.39786 WP_003113791.1.39811 WP_003113791.1.39949 WP_003113791.1.39989 WP_003113791.1.40059 WP_003113791.1.40135 WP_003113791.1.40213 WP_003113791.1.40243 WP_003113791.1.40419 WP_003113791.1.40512 WP_003113791.1.40546 WP_003113791.1.40874 WP_003113791.1.40950 WP_003113791.1.40994 WP_003113791.1.41301 WP_003113791.1.41384 WP_003113791.1.41412 WP_003113791.1.4156 WP_003113791.1.41732 WP_003113791.1.41748 WP_003113791.1.41773 WP_003113791.1.41832 WP_003113791.1.41846 WP_003113791.1.41871 WP_003113791.1.41888 WP_003113791.1.4190 WP_003113791.1.42019 WP_003113791.1.42041 WP_003113791.1.42146 WP_003113791.1.42294 WP_003113791.1.42423 WP_003113791.1.42634 WP_003113791.1.42757 WP_003113791.1.42778 WP_003113791.1.42789 WP_003113791.1.42856 WP_003113791.1.42946 WP_003113791.1.42952 WP_003113791.1.42972 WP_003113791.1.42973 WP_003113791.1.43024 WP_003113791.1.43026 WP_003113791.1.43106 WP_003113791.1.43107 WP_003113791.1.43293 WP_003113791.1.4348 WP_003113791.1.43593 WP_003113791.1.43603 WP_003113791.1.43662 WP_003113791.1.43667 WP_003113791.1.43783 WP_003113791.1.43802 WP_003113791.1.43826 WP_003113791.1.44094 WP_003113791.1.44213 WP_003113791.1.44260 WP_003113791.1.44373 WP_003113791.1.44434 WP_003113791.1.445 WP_003113791.1.44581 WP_003113791.1.44739 WP_003113791.1.44760 WP_003113791.1.44959 WP_003113791.1.45063 WP_003113791.1.45090 WP_003113791.1.45146 WP_003113791.1.45202 WP_003113791.1.45228 WP_003113791.1.45312 WP_003113791.1.45328 WP_003113791.1.45464 WP_003113791.1.45478 WP_003113791.1.45485 WP_003113791.1.45711 WP_003113791.1.45818 WP_003113791.1.45920 WP_003113791.1.45934 WP_003113791.1.46010 WP_003113791.1.46032 WP_003113791.1.46093 WP_003113791.1.461 WP_003113791.1.46152 WP_003113791.1.46200 WP_003113791.1.46502 WP_003113791.1.46755 WP_003113791.1.46787 WP_003113791.1.46826 WP_003113791.1.46866 WP_003113791.1.46926 WP_003113791.1.4699 WP_003113791.1.47101 WP_003113791.1.47155 WP_003113791.1.4726 WP_003113791.1.47296 WP_003113791.1.47469 WP_003113791.1.47480 WP_003113791.1.47527 WP_003113791.1.47645 WP_003113791.1.47970 WP_003113791.1.48001 WP_003113791.1.48086 WP_003113791.1.48141 WP_003113791.1.48172 WP_003113791.1.48321 WP_003113791.1.48334 WP_003113791.1.4836 WP_003113791.1.48378 WP_003113791.1.48413 WP_003113791.1.48545 WP_003113791.1.48576 WP_003113791.1.48747 WP_003113791.1.48820 WP_003113791.1.48842 WP_003113791.1.48961 WP_003113791.1.49135 WP_003113791.1.49265 WP_003113791.1.49266 WP_003113791.1.49286 WP_003113791.1.49416 WP_003113791.1.49500 WP_003113791.1.49557 WP_003113791.1.49566 WP_003113791.1.49688 WP_003113791.1.49798 WP_003113791.1.49833 WP_003113791.1.49842 WP_003113791.1.49976 WP_003113791.1.49998 WP_003113791.1.50176 WP_003113791.1.50222 WP_003113791.1.50242 WP_003113791.1.5043 WP_003113791.1.50567 WP_003113791.1.50653 WP_003113791.1.50665 WP_003113791.1.50668 WP_003113791.1.50682 WP_003113791.1.50734 WP_003113791.1.50814 WP_003113791.1.50989 WP_003113791.1.51019 WP_003113791.1.51035 WP_003113791.1.51141 WP_003113791.1.51183 WP_003113791.1.51267 WP_003113791.1.51273 WP_003113791.1.5132 WP_003113791.1.51538 WP_003113791.1.51549 WP_003113791.1.51585 WP_003113791.1.51682 WP_003113791.1.51807 WP_003113791.1.51937 WP_003113791.1.51943 WP_003113791.1.51976 WP_003113791.1.52043 WP_003113791.1.52220 WP_003113791.1.52244 WP_003113791.1.52326 WP_003113791.1.52334 WP_003113791.1.52355 WP_003113791.1.52537 WP_003113791.1.5258 WP_003113791.1.52583 WP_003113791.1.52690 WP_003113791.1.52700 WP_003113791.1.52728 WP_003113791.1.52784 WP_003113791.1.5294 WP_003113791.1.53070 WP_003113791.1.53287 WP_003113791.1.53719 WP_003113791.1.53726 WP_003113791.1.53932 WP_003113791.1.53948 WP_003113791.1.54090 WP_003113791.1.54146 WP_003113791.1.5420 WP_003113791.1.54248 WP_003113791.1.5427 WP_003113791.1.54462 WP_003113791.1.54497 WP_003113791.1.54571 WP_003113791.1.54742 WP_003113791.1.54809 WP_003113791.1.54974 WP_003113791.1.55089 WP_003113791.1.55169 WP_003113791.1.55318 WP_003113791.1.55347 WP_003113791.1.56013 WP_003113791.1.56145 WP_003113791.1.56196 WP_003113791.1.56229 WP_003113791.1.56315 WP_003113791.1.56348 WP_003113791.1.56452 WP_003113791.1.56474 WP_003113791.1.56475 WP_003113791.1.56623 WP_003113791.1.56745 WP_003113791.1.56797 WP_003113791.1.56808 WP_003113791.1.56819 WP_003113791.1.56973 WP_003113791.1.57005 WP_003113791.1.57113 WP_003113791.1.57131 WP_003113791.1.57276 WP_003113791.1.5731 WP_003113791.1.57532 WP_003113791.1.57566 WP_003113791.1.57728 WP_003113791.1.58019 WP_003113791.1.58183 WP_003113791.1.58193 WP_003113791.1.58228 WP_003113791.1.58482 WP_003113791.1.58527 WP_003113791.1.58689 WP_003113791.1.58838 WP_003113791.1.58845 WP_003113791.1.5889 WP_003113791.1.59099 WP_003113791.1.59176 WP_003113791.1.59246 WP_003113791.1.59563 WP_003113791.1.59688 WP_003113791.1.59724 WP_003113791.1.59759 WP_003113791.1.59797 WP_003113791.1.59831 WP_003113791.1.60051 WP_003113791.1.60062 WP_003113791.1.60085 WP_003113791.1.60206 WP_003113791.1.60261 WP_003113791.1.60347 WP_003113791.1.60415 WP_003113791.1.60600 WP_003113791.1.60602 WP_003113791.1.60603 WP_003113791.1.60686 WP_003113791.1.60910 WP_003113791.1.60916 WP_003113791.1.61122 WP_003113791.1.61130 WP_003113791.1.61209 WP_003113791.1.61222 WP_003113791.1.6130 WP_003113791.1.61598 WP_003113791.1.61696 WP_003113791.1.6173 WP_003113791.1.61943 WP_003113791.1.62035 WP_003113791.1.62357 WP_003113791.1.62410 WP_003113791.1.62483 WP_003113791.1.62516 WP_003113791.1.62534 WP_003113791.1.62635 WP_003113791.1.62688 WP_003113791.1.62701 WP_003113791.1.62704 WP_003113791.1.62716 WP_003113791.1.62768 WP_003113791.1.6283 WP_003113791.1.62834 WP_003113791.1.62873 WP_003113791.1.62917 WP_003113791.1.63041 WP_003113791.1.63124 WP_003113791.1.63193 WP_003113791.1.63196 WP_003113791.1.63338 WP_003113791.1.63597 WP_003113791.1.63634 WP_003113791.1.63995 WP_003113791.1.64139 WP_003113791.1.64155 WP_003113791.1.64198 WP_003113791.1.64309 WP_003113791.1.64329 WP_003113791.1.64340 WP_003113791.1.64433 WP_003113791.1.64591 WP_003113791.1.64807 WP_003113791.1.64854 WP_003113791.1.64862 WP_003113791.1.64880 WP_003113791.1.64885 WP_003113791.1.64984 WP_003113791.1.65009 WP_003113791.1.65092 WP_003113791.1.65099 WP_003113791.1.65145 WP_003113791.1.65285 WP_003113791.1.65304 WP_003113791.1.65316 WP_003113791.1.65334 WP_003113791.1.65335 WP_003113791.1.65337 WP_003113791.1.65642 WP_003113791.1.65740 WP_003113791.1.65819 WP_003113791.1.65926 WP_003113791.1.66277 WP_003113791.1.6629 WP_003113791.1.66348 WP_003113791.1.66371 WP_003113791.1.66526 WP_003113791.1.66634 WP_003113791.1.66721 WP_003113791.1.66929 WP_003113791.1.66931 WP_003113791.1.66945 WP_003113791.1.66950 WP_003113791.1.67188 WP_003113791.1.67192 WP_003113791.1.67205 WP_003113791.1.67261 WP_003113791.1.67370 WP_003113791.1.67388 WP_003113791.1.67472 WP_003113791.1.67526 WP_003113791.1.67531 WP_003113791.1.67545 WP_003113791.1.67686 WP_003113791.1.67755 WP_003113791.1.67830 WP_003113791.1.68000 WP_003113791.1.68158 WP_003113791.1.68183 WP_003113791.1.68252 WP_003113791.1.6850 WP_003113791.1.68541 WP_003113791.1.68568 WP_003113791.1.68756 WP_003113791.1.68781 WP_003113791.1.68800 WP_003113791.1.68850 WP_003113791.1.68857 WP_003113791.1.68862 WP_003113791.1.68938 WP_003113791.1.69088 WP_003113791.1.69159 WP_003113791.1.69260 WP_003113791.1.6928 WP_003113791.1.6937 WP_003113791.1.69534 WP_003113791.1.69556 WP_003113791.1.69702 WP_003113791.1.69788 WP_003113791.1.69819 WP_003113791.1.69834 WP_003113791.1.69907 WP_003113791.1.69993 WP_003113791.1.70092 WP_003113791.1.70194 WP_003113791.1.70216 WP_003113791.1.70229 WP_003113791.1.70460 WP_003113791.1.70470 WP_003113791.1.70648 WP_003113791.1.70670 WP_003113791.1.70693 WP_003113791.1.7077 WP_003113791.1.70778 WP_003113791.1.71038 WP_003113791.1.7128 WP_003113791.1.71385 WP_003113791.1.71570 WP_003113791.1.71642 WP_003113791.1.71666 WP_003113791.1.71799 WP_003113791.1.71806 WP_003113791.1.71891 WP_003113791.1.72149 WP_003113791.1.72167 WP_003113791.1.72181 WP_003113791.1.72287 WP_003113791.1.72323 WP_003113791.1.72331 WP_003113791.1.72541 WP_003113791.1.72570 WP_003113791.1.72653 WP_003113791.1.7276 WP_003113791.1.72768 WP_003113791.1.73048 WP_003113791.1.7308 WP_003113791.1.73135 WP_003113791.1.73149 WP_003113791.1.7327 WP_003113791.1.733 WP_003113791.1.73455 WP_003113791.1.73490 WP_003113791.1.73523 WP_003113791.1.73541 WP_003113791.1.73601 WP_003113791.1.73651 WP_003113791.1.73791 WP_003113791.1.7382 WP_003113791.1.73911 WP_003113791.1.73941 WP_003113791.1.74000 WP_003113791.1.74072 WP_003113791.1.74074 WP_003113791.1.74167 WP_003113791.1.74182 WP_003113791.1.74219 WP_003113791.1.74264 WP_003113791.1.74458 WP_003113791.1.74473 WP_003113791.1.74518 WP_003113791.1.74568 WP_003113791.1.74604 WP_003113791.1.74776 WP_003113791.1.748 WP_003113791.1.74948 WP_003113791.1.74958 WP_003113791.1.75041 WP_003113791.1.75119 WP_003113791.1.75204 WP_003113791.1.7547 WP_003113791.1.75549 WP_003113791.1.75573 WP_003113791.1.75599 WP_003113791.1.75631 WP_003113791.1.75771 WP_003113791.1.75792 WP_003113791.1.75825 WP_003113791.1.7595 WP_003113791.1.76145 WP_003113791.1.76192 WP_003113791.1.76355 WP_003113791.1.76441 WP_003113791.1.76467 WP_003113791.1.76484 WP_003113791.1.76543 WP_003113791.1.76600 WP_003113791.1.76633 WP_003113791.1.76716 WP_003113791.1.76791 WP_003113791.1.76985 WP_003113791.1.77235 WP_003113791.1.77238 WP_003113791.1.77286 WP_003113791.1.77317 WP_003113791.1.77490 WP_003113791.1.77686 WP_003113791.1.77750 WP_003113791.1.77769 WP_003113791.1.7779 WP_003113791.1.77819 WP_003113791.1.77834 WP_003113791.1.78112 WP_003113791.1.78158 WP_003113791.1.78280 WP_003113791.1.78380 WP_003113791.1.78409 WP_003113791.1.78430 WP_003113791.1.78437 WP_003113791.1.78570 WP_003113791.1.78623 WP_003113791.1.78693 WP_003113791.1.78947 WP_003113791.1.78986 WP_003113791.1.79007 WP_003113791.1.79053 WP_003113791.1.79311 WP_003113791.1.7945 WP_003113791.1.79507 WP_003113791.1.7953 WP_003113791.1.79569 WP_003113791.1.79601 WP_003113791.1.79631 WP_003113791.1.79788 WP_003113791.1.79986 WP_003113791.1.80033 WP_003113791.1.80087 WP_003113791.1.80306 WP_003113791.1.80410 WP_003113791.1.80481 WP_003113791.1.8051 WP_003113791.1.80535 WP_003113791.1.8064 WP_003113791.1.80645 WP_003113791.1.80846 WP_003113791.1.80892 WP_003113791.1.80931 WP_003113791.1.81081 WP_003113791.1.81082 WP_003113791.1.8110 WP_003113791.1.81206 WP_003113791.1.81331 WP_003113791.1.81482 WP_003113791.1.81487 WP_003113791.1.81581 WP_003113791.1.81622 WP_003113791.1.81643 WP_003113791.1.81742 WP_003113791.1.81771 WP_003113791.1.81784 WP_003113791.1.81802 WP_003113791.1.81816 WP_003113791.1.81844 WP_003113791.1.81950 WP_003113791.1.82117 WP_003113791.1.82127 WP_003113791.1.82310 WP_003113791.1.82312 WP_003113791.1.82334 WP_003113791.1.82606 WP_003113791.1.82710 WP_003113791.1.8284 WP_003113791.1.82864 WP_003113791.1.82936 WP_003113791.1.83184 WP_003113791.1.83213 WP_003113791.1.83251 WP_003113791.1.83296 WP_003113791.1.83394 WP_003113791.1.835 WP_003113791.1.8353 WP_003113791.1.83534 WP_003113791.1.8357 WP_003113791.1.83715 WP_003113791.1.83946 WP_003113791.1.84008 WP_003113791.1.84174 WP_003113791.1.84190 WP_003113791.1.84203 WP_003113791.1.84271 WP_003113791.1.84374 WP_003113791.1.84398 WP_003113791.1.84471 WP_003113791.1.84538 WP_003113791.1.84589 WP_003113791.1.84674 WP_003113791.1.84702 WP_003113791.1.84715 WP_003113791.1.84792 WP_003113791.1.84946 WP_003113791.1.8498 WP_003113791.1.85018 WP_003113791.1.85059 WP_003113791.1.85220 WP_003113791.1.85290 WP_003113791.1.85303 WP_003113791.1.85318 WP_003113791.1.85574 WP_003113791.1.85633 WP_003113791.1.85788 WP_003113791.1.85897 WP_003113791.1.86058 WP_003113791.1.86125 WP_003113791.1.86278 WP_003113791.1.86287 WP_003113791.1.86293 WP_003113791.1.865 WP_003113791.1.86545 WP_003113791.1.86552 WP_003113791.1.867 WP_003113791.1.86708 WP_003113791.1.86733 WP_003113791.1.86785 WP_003113791.1.86813 WP_003113791.1.86985 WP_003113791.1.8718 WP_003113791.1.87182 WP_003113791.1.8727 WP_003113791.1.87316 WP_003113791.1.87390 WP_003113791.1.87435 WP_003113791.1.8749 WP_003113791.1.87530 WP_003113791.1.87648 WP_003113791.1.87763 WP_003113791.1.87981 WP_003113791.1.88004 WP_003113791.1.88308 WP_003113791.1.88330 WP_003113791.1.88550 WP_003113791.1.88578 WP_003113791.1.88605 WP_003113791.1.88714 WP_003113791.1.88750 WP_003113791.1.88900 WP_003113791.1.88949 WP_003113791.1.8911 WP_003113791.1.89234 WP_003113791.1.89245 WP_003113791.1.89266 WP_003113791.1.89276 WP_003113791.1.89409 WP_003113791.1.89440 WP_003113791.1.8949 WP_003113791.1.89491 WP_003113791.1.89577 WP_003113791.1.89610 WP_003113791.1.89662 WP_003113791.1.89669 WP_003113791.1.89736 WP_003113791.1.8976 WP_003113791.1.89805 WP_003113791.1.89866 WP_003113791.1.89868 WP_003113791.1.89886 WP_003113791.1.90024 WP_003113791.1.90056 WP_003113791.1.90150 WP_003113791.1.90225 WP_003113791.1.90242 WP_003113791.1.90306 WP_003113791.1.90412 WP_003113791.1.9056 WP_003113791.1.90569 WP_003113791.1.90770 WP_003113791.1.91093 WP_003113791.1.91161 WP_003113791.1.9120 WP_003113791.1.91204 WP_003113791.1.91360 WP_003113791.1.91416 WP_003113791.1.9143 WP_003113791.1.91431 WP_003113791.1.91438 WP_003113791.1.91803 WP_003113791.1.91846 WP_003113791.1.91860 WP_003113791.1.91862 WP_003113791.1.92175 WP_003113791.1.92314 WP_003113791.1.92321 WP_003113791.1.92357 WP_003113791.1.92454 WP_003113791.1.92573 WP_003113791.1.92589 WP_003113791.1.92769 WP_003113791.1.92839 WP_003113791.1.92847 WP_003113791.1.92930 WP_003113791.1.93001 WP_003113791.1.93122 WP_003113791.1.93148 WP_003113791.1.93250 WP_003113791.1.9328 WP_003113791.1.93446 WP_003113791.1.9349 WP_003113791.1.93493 WP_003113791.1.93498 WP_003113791.1.93797 WP_003113791.1.93848 WP_003113791.1.93897 WP_003113791.1.94004 WP_003113791.1.94174 WP_003113791.1.94218 WP_003113791.1.94243 WP_003113791.1.94285 WP_003113791.1.94385 WP_003113791.1.94682 WP_003113791.1.94856 WP_003113791.1.94874 WP_003113791.1.94896 WP_003113791.1.94897 WP_003113791.1.95027 WP_003113791.1.95117 WP_003113791.1.95132 WP_003113791.1.95187 WP_003113791.1.95207 WP_003113791.1.95305 WP_003113791.1.95324 WP_003113791.1.95488 WP_003113791.1.95525 WP_003113791.1.95536 WP_003113791.1.95668 WP_003113791.1.95745 WP_003113791.1.95751 WP_003113791.1.95802 WP_003113791.1.95820 WP_003113791.1.95825 WP_003113791.1.9599 WP_003113791.1.95994 WP_003113791.1.96008 WP_003113791.1.96193 WP_003113791.1.96243 WP_003113791.1.96267 WP_003113791.1.96357 WP_003113791.1.96667 WP_003113791.1.96702 WP_003113791.1.96880 WP_003113791.1.96967 WP_003113791.1.9706 WP_003113791.1.97118 WP_003113791.1.97126 WP_003113791.1.97213 WP_003113791.1.9722 WP_003113791.1.97271 WP_003113791.1.97272 WP_003113791.1.97474 WP_003113791.1.97614 WP_003113791.1.97826 WP_003113791.1.97968 WP_003113791.1.98276 WP_003113791.1.98308 WP_003113791.1.98410 WP_003113791.1.98414 WP_003113791.1.98433 WP_003113791.1.98522 WP_003113791.1.98573 WP_003113791.1.98600 WP_003113791.1.98610 WP_003113791.1.98672 WP_003113791.1.98693 WP_003113791.1.98788 WP_003113791.1.99068 WP_003113791.1.99103 WP_003113791.1.99214 WP_003113791.1.99293 WP_003113791.1.99386 WP_003113791.1.99461 WP_003113791.1.9951 WP_003113791.1.99654 WP_003113791.1.99662 WP_003113791.1.99746 WP_003113791.1.99757 WP_003113791.1.99795 WP_003113791.1.99835 WP_003113791.1.9989 WP_003113791.1.99930 gi|386057164|ref|YP_005973686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]