SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152810|ref|YP_008941764.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152810|ref|YP_008941764.1|
Domain Number 1 Region: 102-256
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-42
Family Reductases 0.000000422
Further Details:      
 
Domain Number 2 Region: 3-99
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.33e-27
Family Ferredoxin reductase FAD-binding domain-like 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568152810|ref|YP_008941764.1|
Sequence length 258
Comment ferredoxin--NADP reductase [Pseudomonas aeruginosa LES431]
Sequence
MSNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNY
EEHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMA
PFLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLV
TREPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDRAMICGSPSMLEETSAVLDSFGLKIS
PRMGEPGDYLIERAFVEK
Download sequence
Identical sequences A0A071LCT3 A0A0E1ARN4 A0A0H2ZE93 A0A0H3R0V6 A0A157WIJ7 A0A1C7BNH6 A0A1E9BZJ0 A0A1F0IF91 A0A1G5EUY2 A0A1S1C7G1 Q9HYK7 V6AB96 W1MIS7
gi|386067437|ref|YP_005982741.1| 208963.PA14_20140 208964.PA3397 557722.PLES_16641 gi|568308388|ref|YP_008980657.1| gi|392982865|ref|YP_006481452.1| gi|386057637|ref|YP_005974159.1| gi|116051415|ref|YP_789752.1| NP_252087.1.87394 WP_003091832.1.100071 WP_003091832.1.100100 WP_003091832.1.100179 WP_003091832.1.100276 WP_003091832.1.100278 WP_003091832.1.100319 WP_003091832.1.100394 WP_003091832.1.100420 WP_003091832.1.100456 WP_003091832.1.100469 WP_003091832.1.100473 WP_003091832.1.100476 WP_003091832.1.100523 WP_003091832.1.100654 WP_003091832.1.100723 WP_003091832.1.100742 WP_003091832.1.100777 WP_003091832.1.100786 WP_003091832.1.100808 WP_003091832.1.100809 WP_003091832.1.100810 WP_003091832.1.100872 WP_003091832.1.100983 WP_003091832.1.100995 WP_003091832.1.101021 WP_003091832.1.101047 WP_003091832.1.101090 WP_003091832.1.101269 WP_003091832.1.101310 WP_003091832.1.101340 WP_003091832.1.101506 WP_003091832.1.101572 WP_003091832.1.101590 WP_003091832.1.101642 WP_003091832.1.101712 WP_003091832.1.101739 WP_003091832.1.10174 WP_003091832.1.101781 WP_003091832.1.10179 WP_003091832.1.101809 WP_003091832.1.101819 WP_003091832.1.10185 WP_003091832.1.101863 WP_003091832.1.101871 WP_003091832.1.10201 WP_003091832.1.10202 WP_003091832.1.10204 WP_003091832.1.102045 WP_003091832.1.10228 WP_003091832.1.10248 WP_003091832.1.10257 WP_003091832.1.10271 WP_003091832.1.1037 WP_003091832.1.10407 WP_003091832.1.10419 WP_003091832.1.10435 WP_003091832.1.10457 WP_003091832.1.10468 WP_003091832.1.10477 WP_003091832.1.10482 WP_003091832.1.10513 WP_003091832.1.10529 WP_003091832.1.10548 WP_003091832.1.10572 WP_003091832.1.10575 WP_003091832.1.10636 WP_003091832.1.10641 WP_003091832.1.10684 WP_003091832.1.10764 WP_003091832.1.10856 WP_003091832.1.10895 WP_003091832.1.10901 WP_003091832.1.10949 WP_003091832.1.11026 WP_003091832.1.11058 WP_003091832.1.1107 WP_003091832.1.11077 WP_003091832.1.1109 WP_003091832.1.11130 WP_003091832.1.11163 WP_003091832.1.11178 WP_003091832.1.11180 WP_003091832.1.11318 WP_003091832.1.11381 WP_003091832.1.11388 WP_003091832.1.11410 WP_003091832.1.11417 WP_003091832.1.11454 WP_003091832.1.11568 WP_003091832.1.11569 WP_003091832.1.11653 WP_003091832.1.11744 WP_003091832.1.11754 WP_003091832.1.1180 WP_003091832.1.1183 WP_003091832.1.11847 WP_003091832.1.11854 WP_003091832.1.1187 WP_003091832.1.11943 WP_003091832.1.12018 WP_003091832.1.12081 WP_003091832.1.12120 WP_003091832.1.12150 WP_003091832.1.12200 WP_003091832.1.12208 WP_003091832.1.12240 WP_003091832.1.12302 WP_003091832.1.12354 WP_003091832.1.1238 WP_003091832.1.12400 WP_003091832.1.12482 WP_003091832.1.12497 WP_003091832.1.12530 WP_003091832.1.12547 WP_003091832.1.12561 WP_003091832.1.12657 WP_003091832.1.12660 WP_003091832.1.12670 WP_003091832.1.12687 WP_003091832.1.12744 WP_003091832.1.12797 WP_003091832.1.12838 WP_003091832.1.12873 WP_003091832.1.12890 WP_003091832.1.12891 WP_003091832.1.12922 WP_003091832.1.12930 WP_003091832.1.12934 WP_003091832.1.12970 WP_003091832.1.12980 WP_003091832.1.13 WP_003091832.1.13041 WP_003091832.1.1305 WP_003091832.1.13057 WP_003091832.1.13077 WP_003091832.1.13085 WP_003091832.1.13092 WP_003091832.1.13208 WP_003091832.1.13232 WP_003091832.1.13242 WP_003091832.1.13266 WP_003091832.1.13270 WP_003091832.1.13315 WP_003091832.1.1333 WP_003091832.1.13364 WP_003091832.1.13407 WP_003091832.1.13529 WP_003091832.1.13533 WP_003091832.1.1356 WP_003091832.1.1362 WP_003091832.1.13622 WP_003091832.1.13642 WP_003091832.1.13718 WP_003091832.1.13743 WP_003091832.1.13758 WP_003091832.1.13765 WP_003091832.1.13785 WP_003091832.1.13795 WP_003091832.1.13828 WP_003091832.1.13865 WP_003091832.1.1393 WP_003091832.1.14049 WP_003091832.1.14078 WP_003091832.1.14096 WP_003091832.1.14116 WP_003091832.1.14204 WP_003091832.1.14251 WP_003091832.1.14378 WP_003091832.1.14424 WP_003091832.1.14455 WP_003091832.1.14460 WP_003091832.1.14463 WP_003091832.1.14476 WP_003091832.1.14525 WP_003091832.1.14564 WP_003091832.1.14615 WP_003091832.1.14640 WP_003091832.1.14679 WP_003091832.1.14690 WP_003091832.1.14714 WP_003091832.1.1475 WP_003091832.1.14754 WP_003091832.1.14797 WP_003091832.1.14815 WP_003091832.1.14820 WP_003091832.1.14835 WP_003091832.1.14839 WP_003091832.1.14883 WP_003091832.1.14966 WP_003091832.1.14981 WP_003091832.1.15004 WP_003091832.1.15130 WP_003091832.1.1516 WP_003091832.1.152 WP_003091832.1.15222 WP_003091832.1.15231 WP_003091832.1.15281 WP_003091832.1.15297 WP_003091832.1.15328 WP_003091832.1.15373 WP_003091832.1.15379 WP_003091832.1.15408 WP_003091832.1.15474 WP_003091832.1.15480 WP_003091832.1.15482 WP_003091832.1.15485 WP_003091832.1.15602 WP_003091832.1.15606 WP_003091832.1.15666 WP_003091832.1.15692 WP_003091832.1.15886 WP_003091832.1.15889 WP_003091832.1.16041 WP_003091832.1.16074 WP_003091832.1.16109 WP_003091832.1.16142 WP_003091832.1.16161 WP_003091832.1.16197 WP_003091832.1.162 WP_003091832.1.16239 WP_003091832.1.16242 WP_003091832.1.16267 WP_003091832.1.16279 WP_003091832.1.16419 WP_003091832.1.1646 WP_003091832.1.16660 WP_003091832.1.16694 WP_003091832.1.1670 WP_003091832.1.1671 WP_003091832.1.16751 WP_003091832.1.16782 WP_003091832.1.16788 WP_003091832.1.16801 WP_003091832.1.16808 WP_003091832.1.16811 WP_003091832.1.16895 WP_003091832.1.17022 WP_003091832.1.1704 WP_003091832.1.17108 WP_003091832.1.17155 WP_003091832.1.17162 WP_003091832.1.17177 WP_003091832.1.17189 WP_003091832.1.172 WP_003091832.1.17223 WP_003091832.1.17353 WP_003091832.1.17354 WP_003091832.1.17370 WP_003091832.1.1739 WP_003091832.1.17397 WP_003091832.1.17499 WP_003091832.1.17566 WP_003091832.1.1758 WP_003091832.1.1761 WP_003091832.1.17697 WP_003091832.1.17883 WP_003091832.1.17890 WP_003091832.1.18052 WP_003091832.1.18054 WP_003091832.1.18117 WP_003091832.1.18156 WP_003091832.1.18157 WP_003091832.1.18199 WP_003091832.1.18204 WP_003091832.1.18234 WP_003091832.1.1824 WP_003091832.1.18349 WP_003091832.1.18440 WP_003091832.1.18493 WP_003091832.1.18508 WP_003091832.1.18547 WP_003091832.1.18653 WP_003091832.1.18728 WP_003091832.1.18732 WP_003091832.1.18735 WP_003091832.1.18769 WP_003091832.1.18795 WP_003091832.1.18852 WP_003091832.1.18892 WP_003091832.1.18907 WP_003091832.1.18911 WP_003091832.1.18930 WP_003091832.1.190 WP_003091832.1.19089 WP_003091832.1.19199 WP_003091832.1.19251 WP_003091832.1.19260 WP_003091832.1.19269 WP_003091832.1.19346 WP_003091832.1.19351 WP_003091832.1.19376 WP_003091832.1.1938 WP_003091832.1.19552 WP_003091832.1.19591 WP_003091832.1.19640 WP_003091832.1.19703 WP_003091832.1.1971 WP_003091832.1.19711 WP_003091832.1.19718 WP_003091832.1.19741 WP_003091832.1.19771 WP_003091832.1.19803 WP_003091832.1.19824 WP_003091832.1.19930 WP_003091832.1.19931 WP_003091832.1.20024 WP_003091832.1.20070 WP_003091832.1.2012 WP_003091832.1.20125 WP_003091832.1.20134 WP_003091832.1.20154 WP_003091832.1.20216 WP_003091832.1.20342 WP_003091832.1.20590 WP_003091832.1.20682 WP_003091832.1.20692 WP_003091832.1.20744 WP_003091832.1.20764 WP_003091832.1.20825 WP_003091832.1.20854 WP_003091832.1.20880 WP_003091832.1.20884 WP_003091832.1.20890 WP_003091832.1.209 WP_003091832.1.20929 WP_003091832.1.20978 WP_003091832.1.21002 WP_003091832.1.21039 WP_003091832.1.21096 WP_003091832.1.21100 WP_003091832.1.21166 WP_003091832.1.21209 WP_003091832.1.21242 WP_003091832.1.21253 WP_003091832.1.21302 WP_003091832.1.21349 WP_003091832.1.21358 WP_003091832.1.2144 WP_003091832.1.21448 WP_003091832.1.21460 WP_003091832.1.21469 WP_003091832.1.21471 WP_003091832.1.21517 WP_003091832.1.21607 WP_003091832.1.21718 WP_003091832.1.2172 WP_003091832.1.21744 WP_003091832.1.21767 WP_003091832.1.21782 WP_003091832.1.21801 WP_003091832.1.21863 WP_003091832.1.21871 WP_003091832.1.21891 WP_003091832.1.21932 WP_003091832.1.22078 WP_003091832.1.221 WP_003091832.1.2228 WP_003091832.1.22316 WP_003091832.1.22324 WP_003091832.1.22365 WP_003091832.1.2237 WP_003091832.1.22390 WP_003091832.1.22394 WP_003091832.1.22442 WP_003091832.1.22477 WP_003091832.1.22491 WP_003091832.1.22573 WP_003091832.1.22671 WP_003091832.1.22704 WP_003091832.1.22729 WP_003091832.1.22863 WP_003091832.1.2289 WP_003091832.1.22891 WP_003091832.1.23013 WP_003091832.1.23166 WP_003091832.1.23191 WP_003091832.1.23195 WP_003091832.1.2323 WP_003091832.1.23264 WP_003091832.1.23331 WP_003091832.1.23394 WP_003091832.1.23418 WP_003091832.1.23421 WP_003091832.1.23512 WP_003091832.1.23518 WP_003091832.1.23523 WP_003091832.1.23525 WP_003091832.1.2355 WP_003091832.1.23559 WP_003091832.1.23581 WP_003091832.1.236 WP_003091832.1.23611 WP_003091832.1.23641 WP_003091832.1.23715 WP_003091832.1.23739 WP_003091832.1.2374 WP_003091832.1.23769 WP_003091832.1.23782 WP_003091832.1.23794 WP_003091832.1.23884 WP_003091832.1.23925 WP_003091832.1.23938 WP_003091832.1.23961 WP_003091832.1.23967 WP_003091832.1.23983 WP_003091832.1.24066 WP_003091832.1.24077 WP_003091832.1.24087 WP_003091832.1.24101 WP_003091832.1.24183 WP_003091832.1.24234 WP_003091832.1.24319 WP_003091832.1.24351 WP_003091832.1.24382 WP_003091832.1.24413 WP_003091832.1.24447 WP_003091832.1.2453 WP_003091832.1.24626 WP_003091832.1.24662 WP_003091832.1.2477 WP_003091832.1.24851 WP_003091832.1.24862 WP_003091832.1.24869 WP_003091832.1.24879 WP_003091832.1.24938 WP_003091832.1.24940 WP_003091832.1.25033 WP_003091832.1.25052 WP_003091832.1.25067 WP_003091832.1.25075 WP_003091832.1.251 WP_003091832.1.25109 WP_003091832.1.2511 WP_003091832.1.25142 WP_003091832.1.25149 WP_003091832.1.25179 WP_003091832.1.25191 WP_003091832.1.25271 WP_003091832.1.2529 WP_003091832.1.2530 WP_003091832.1.25328 WP_003091832.1.25344 WP_003091832.1.25348 WP_003091832.1.2535 WP_003091832.1.25477 WP_003091832.1.25532 WP_003091832.1.25600 WP_003091832.1.25641 WP_003091832.1.25675 WP_003091832.1.25695 WP_003091832.1.2572 WP_003091832.1.25834 WP_003091832.1.25903 WP_003091832.1.2596 WP_003091832.1.25964 WP_003091832.1.26010 WP_003091832.1.26025 WP_003091832.1.26042 WP_003091832.1.261 WP_003091832.1.26159 WP_003091832.1.26334 WP_003091832.1.26428 WP_003091832.1.26463 WP_003091832.1.26473 WP_003091832.1.26489 WP_003091832.1.2652 WP_003091832.1.26539 WP_003091832.1.26553 WP_003091832.1.26592 WP_003091832.1.26604 WP_003091832.1.26681 WP_003091832.1.26705 WP_003091832.1.26740 WP_003091832.1.26816 WP_003091832.1.26841 WP_003091832.1.26862 WP_003091832.1.26906 WP_003091832.1.26967 WP_003091832.1.2698 WP_003091832.1.27018 WP_003091832.1.27028 WP_003091832.1.27039 WP_003091832.1.27073 WP_003091832.1.27107 WP_003091832.1.27211 WP_003091832.1.27218 WP_003091832.1.27259 WP_003091832.1.27288 WP_003091832.1.27505 WP_003091832.1.27534 WP_003091832.1.27549 WP_003091832.1.27575 WP_003091832.1.27587 WP_003091832.1.27687 WP_003091832.1.27738 WP_003091832.1.27772 WP_003091832.1.27783 WP_003091832.1.27825 WP_003091832.1.27837 WP_003091832.1.27858 WP_003091832.1.27933 WP_003091832.1.27939 WP_003091832.1.27966 WP_003091832.1.28006 WP_003091832.1.28057 WP_003091832.1.28064 WP_003091832.1.28078 WP_003091832.1.28136 WP_003091832.1.28175 WP_003091832.1.28193 WP_003091832.1.28258 WP_003091832.1.283 WP_003091832.1.28316 WP_003091832.1.28329 WP_003091832.1.28372 WP_003091832.1.28382 WP_003091832.1.28383 WP_003091832.1.28404 WP_003091832.1.28468 WP_003091832.1.28505 WP_003091832.1.28528 WP_003091832.1.28560 WP_003091832.1.28602 WP_003091832.1.28623 WP_003091832.1.28699 WP_003091832.1.28713 WP_003091832.1.28757 WP_003091832.1.28800 WP_003091832.1.28823 WP_003091832.1.28838 WP_003091832.1.28849 WP_003091832.1.28878 WP_003091832.1.29003 WP_003091832.1.29008 WP_003091832.1.29062 WP_003091832.1.29070 WP_003091832.1.29096 WP_003091832.1.29127 WP_003091832.1.29137 WP_003091832.1.29158 WP_003091832.1.29179 WP_003091832.1.29208 WP_003091832.1.2927 WP_003091832.1.29401 WP_003091832.1.2941 WP_003091832.1.29438 WP_003091832.1.29440 WP_003091832.1.29472 WP_003091832.1.2948 WP_003091832.1.29481 WP_003091832.1.29498 WP_003091832.1.29501 WP_003091832.1.29577 WP_003091832.1.2961 WP_003091832.1.29633 WP_003091832.1.29650 WP_003091832.1.29668 WP_003091832.1.29753 WP_003091832.1.29767 WP_003091832.1.2980 WP_003091832.1.29848 WP_003091832.1.29920 WP_003091832.1.29958 WP_003091832.1.29973 WP_003091832.1.30000 WP_003091832.1.30020 WP_003091832.1.30081 WP_003091832.1.30120 WP_003091832.1.30254 WP_003091832.1.3030 WP_003091832.1.30365 WP_003091832.1.30474 WP_003091832.1.30475 WP_003091832.1.30563 WP_003091832.1.30567 WP_003091832.1.30614 WP_003091832.1.30615 WP_003091832.1.30625 WP_003091832.1.30693 WP_003091832.1.30707 WP_003091832.1.3072 WP_003091832.1.30740 WP_003091832.1.30797 WP_003091832.1.30815 WP_003091832.1.30842 WP_003091832.1.30886 WP_003091832.1.30943 WP_003091832.1.30973 WP_003091832.1.30994 WP_003091832.1.31045 WP_003091832.1.31076 WP_003091832.1.31087 WP_003091832.1.31103 WP_003091832.1.31105 WP_003091832.1.31138 WP_003091832.1.31147 WP_003091832.1.31279 WP_003091832.1.31361 WP_003091832.1.31457 WP_003091832.1.31501 WP_003091832.1.31563 WP_003091832.1.31565 WP_003091832.1.31587 WP_003091832.1.31633 WP_003091832.1.31655 WP_003091832.1.3172 WP_003091832.1.31732 WP_003091832.1.31741 WP_003091832.1.31751 WP_003091832.1.3179 WP_003091832.1.31848 WP_003091832.1.31852 WP_003091832.1.319 WP_003091832.1.31939 WP_003091832.1.32134 WP_003091832.1.32137 WP_003091832.1.32144 WP_003091832.1.32235 WP_003091832.1.32289 WP_003091832.1.32314 WP_003091832.1.32359 WP_003091832.1.32447 WP_003091832.1.32523 WP_003091832.1.32544 WP_003091832.1.32596 WP_003091832.1.32626 WP_003091832.1.32637 WP_003091832.1.32641 WP_003091832.1.32711 WP_003091832.1.32821 WP_003091832.1.32869 WP_003091832.1.32879 WP_003091832.1.32998 WP_003091832.1.33009 WP_003091832.1.33047 WP_003091832.1.33097 WP_003091832.1.33133 WP_003091832.1.33152 WP_003091832.1.33186 WP_003091832.1.33204 WP_003091832.1.33210 WP_003091832.1.33216 WP_003091832.1.33294 WP_003091832.1.33340 WP_003091832.1.33387 WP_003091832.1.33438 WP_003091832.1.33441 WP_003091832.1.33455 WP_003091832.1.3351 WP_003091832.1.33517 WP_003091832.1.33523 WP_003091832.1.33547 WP_003091832.1.33549 WP_003091832.1.33653 WP_003091832.1.33658 WP_003091832.1.33669 WP_003091832.1.3368 WP_003091832.1.33728 WP_003091832.1.33733 WP_003091832.1.33734 WP_003091832.1.3376 WP_003091832.1.33774 WP_003091832.1.33801 WP_003091832.1.33814 WP_003091832.1.33824 WP_003091832.1.33833 WP_003091832.1.3385 WP_003091832.1.33945 WP_003091832.1.34000 WP_003091832.1.34039 WP_003091832.1.34136 WP_003091832.1.34143 WP_003091832.1.34150 WP_003091832.1.34151 WP_003091832.1.34180 WP_003091832.1.34191 WP_003091832.1.34203 WP_003091832.1.34306 WP_003091832.1.34317 WP_003091832.1.34324 WP_003091832.1.3436 WP_003091832.1.34401 WP_003091832.1.34402 WP_003091832.1.34461 WP_003091832.1.34465 WP_003091832.1.34472 WP_003091832.1.3452 WP_003091832.1.34556 WP_003091832.1.34568 WP_003091832.1.34583 WP_003091832.1.34625 WP_003091832.1.34689 WP_003091832.1.34784 WP_003091832.1.34821 WP_003091832.1.34832 WP_003091832.1.34836 WP_003091832.1.34837 WP_003091832.1.34876 WP_003091832.1.34878 WP_003091832.1.34901 WP_003091832.1.34922 WP_003091832.1.34942 WP_003091832.1.35036 WP_003091832.1.35104 WP_003091832.1.35149 WP_003091832.1.35231 WP_003091832.1.35281 WP_003091832.1.3531 WP_003091832.1.35325 WP_003091832.1.35353 WP_003091832.1.3540 WP_003091832.1.35431 WP_003091832.1.35442 WP_003091832.1.35480 WP_003091832.1.35512 WP_003091832.1.35529 WP_003091832.1.3555 WP_003091832.1.35573 WP_003091832.1.35599 WP_003091832.1.35639 WP_003091832.1.35641 WP_003091832.1.35669 WP_003091832.1.35679 WP_003091832.1.3568 WP_003091832.1.35682 WP_003091832.1.3576 WP_003091832.1.35762 WP_003091832.1.35768 WP_003091832.1.35822 WP_003091832.1.35843 WP_003091832.1.35857 WP_003091832.1.35872 WP_003091832.1.35968 WP_003091832.1.35984 WP_003091832.1.36064 WP_003091832.1.36121 WP_003091832.1.36148 WP_003091832.1.36170 WP_003091832.1.36266 WP_003091832.1.36267 WP_003091832.1.36285 WP_003091832.1.36378 WP_003091832.1.36435 WP_003091832.1.36487 WP_003091832.1.36521 WP_003091832.1.3653 WP_003091832.1.36587 WP_003091832.1.36608 WP_003091832.1.3662 WP_003091832.1.36630 WP_003091832.1.36665 WP_003091832.1.36708 WP_003091832.1.3672 WP_003091832.1.36756 WP_003091832.1.36781 WP_003091832.1.36879 WP_003091832.1.37050 WP_003091832.1.37097 WP_003091832.1.37125 WP_003091832.1.37163 WP_003091832.1.37172 WP_003091832.1.37208 WP_003091832.1.3721 WP_003091832.1.37216 WP_003091832.1.373 WP_003091832.1.37319 WP_003091832.1.37366 WP_003091832.1.37416 WP_003091832.1.3742 WP_003091832.1.37500 WP_003091832.1.37512 WP_003091832.1.37571 WP_003091832.1.3768 WP_003091832.1.37698 WP_003091832.1.37703 WP_003091832.1.3773 WP_003091832.1.37799 WP_003091832.1.3781 WP_003091832.1.37814 WP_003091832.1.37818 WP_003091832.1.37826 WP_003091832.1.37842 WP_003091832.1.3785 WP_003091832.1.3792 WP_003091832.1.38003 WP_003091832.1.38023 WP_003091832.1.38060 WP_003091832.1.38087 WP_003091832.1.38102 WP_003091832.1.38146 WP_003091832.1.38151 WP_003091832.1.3818 WP_003091832.1.38186 WP_003091832.1.3821 WP_003091832.1.38319 WP_003091832.1.3833 WP_003091832.1.38335 WP_003091832.1.38337 WP_003091832.1.38406 WP_003091832.1.38430 WP_003091832.1.38450 WP_003091832.1.38502 WP_003091832.1.38505 WP_003091832.1.38510 WP_003091832.1.38582 WP_003091832.1.38583 WP_003091832.1.38587 WP_003091832.1.38657 WP_003091832.1.38661 WP_003091832.1.3870 WP_003091832.1.38706 WP_003091832.1.38727 WP_003091832.1.38816 WP_003091832.1.38834 WP_003091832.1.3887 WP_003091832.1.38889 WP_003091832.1.38932 WP_003091832.1.38971 WP_003091832.1.39046 WP_003091832.1.39088 WP_003091832.1.39122 WP_003091832.1.39186 WP_003091832.1.39271 WP_003091832.1.39326 WP_003091832.1.39345 WP_003091832.1.3943 WP_003091832.1.39444 WP_003091832.1.39452 WP_003091832.1.39458 WP_003091832.1.39537 WP_003091832.1.39704 WP_003091832.1.39765 WP_003091832.1.39786 WP_003091832.1.39811 WP_003091832.1.39920 WP_003091832.1.39949 WP_003091832.1.3998 WP_003091832.1.39989 WP_003091832.1.40059 WP_003091832.1.40135 WP_003091832.1.40207 WP_003091832.1.40213 WP_003091832.1.40237 WP_003091832.1.40243 WP_003091832.1.40271 WP_003091832.1.4038 WP_003091832.1.40419 WP_003091832.1.40442 WP_003091832.1.40512 WP_003091832.1.40513 WP_003091832.1.40541 WP_003091832.1.40546 WP_003091832.1.4058 WP_003091832.1.40595 WP_003091832.1.40703 WP_003091832.1.40874 WP_003091832.1.40950 WP_003091832.1.40984 WP_003091832.1.40993 WP_003091832.1.40994 WP_003091832.1.41110 WP_003091832.1.41137 WP_003091832.1.41199 WP_003091832.1.41290 WP_003091832.1.41291 WP_003091832.1.41301 WP_003091832.1.41384 WP_003091832.1.41412 WP_003091832.1.41429 WP_003091832.1.41487 WP_003091832.1.41492 WP_003091832.1.41502 WP_003091832.1.4156 WP_003091832.1.41618 WP_003091832.1.41624 WP_003091832.1.41625 WP_003091832.1.41692 WP_003091832.1.41703 WP_003091832.1.41725 WP_003091832.1.41732 WP_003091832.1.41748 WP_003091832.1.41773 WP_003091832.1.41832 WP_003091832.1.41846 WP_003091832.1.41871 WP_003091832.1.41888 WP_003091832.1.4190 WP_003091832.1.41939 WP_003091832.1.4196 WP_003091832.1.42 WP_003091832.1.42019 WP_003091832.1.42041 WP_003091832.1.42047 WP_003091832.1.42146 WP_003091832.1.42259 WP_003091832.1.42294 WP_003091832.1.42316 WP_003091832.1.42381 WP_003091832.1.42388 WP_003091832.1.42411 WP_003091832.1.42423 WP_003091832.1.42463 WP_003091832.1.42499 WP_003091832.1.42508 WP_003091832.1.42634 WP_003091832.1.42643 WP_003091832.1.42690 WP_003091832.1.42696 WP_003091832.1.42723 WP_003091832.1.4273 WP_003091832.1.42754 WP_003091832.1.42757 WP_003091832.1.42778 WP_003091832.1.42789 WP_003091832.1.42854 WP_003091832.1.42856 WP_003091832.1.42870 WP_003091832.1.42917 WP_003091832.1.42946 WP_003091832.1.42952 WP_003091832.1.42972 WP_003091832.1.42973 WP_003091832.1.43022 WP_003091832.1.43024 WP_003091832.1.43026 WP_003091832.1.43049 WP_003091832.1.43106 WP_003091832.1.43107 WP_003091832.1.43212 WP_003091832.1.43245 WP_003091832.1.43286 WP_003091832.1.43293 WP_003091832.1.43315 WP_003091832.1.43326 WP_003091832.1.43330 WP_003091832.1.43356 WP_003091832.1.4348 WP_003091832.1.43593 WP_003091832.1.43603 WP_003091832.1.43662 WP_003091832.1.43667 WP_003091832.1.43673 WP_003091832.1.43696 WP_003091832.1.43729 WP_003091832.1.43756 WP_003091832.1.43783 WP_003091832.1.43802 WP_003091832.1.4381 WP_003091832.1.43811 WP_003091832.1.43826 WP_003091832.1.4397 WP_003091832.1.4398 WP_003091832.1.43998 WP_003091832.1.44046 WP_003091832.1.44094 WP_003091832.1.44213 WP_003091832.1.44260 WP_003091832.1.44269 WP_003091832.1.44373 WP_003091832.1.44434 WP_003091832.1.44486 WP_003091832.1.445 WP_003091832.1.44552 WP_003091832.1.44563 WP_003091832.1.44565 WP_003091832.1.44581 WP_003091832.1.44725 WP_003091832.1.44739 WP_003091832.1.44760 WP_003091832.1.44804 WP_003091832.1.44870 WP_003091832.1.4493 WP_003091832.1.44959 WP_003091832.1.45063 WP_003091832.1.45090 WP_003091832.1.45146 WP_003091832.1.45199 WP_003091832.1.45202 WP_003091832.1.4522 WP_003091832.1.45228 WP_003091832.1.45298 WP_003091832.1.45306 WP_003091832.1.45312 WP_003091832.1.4532 WP_003091832.1.45328 WP_003091832.1.45353 WP_003091832.1.45358 WP_003091832.1.45464 WP_003091832.1.45478 WP_003091832.1.45485 WP_003091832.1.45604 WP_003091832.1.45611 WP_003091832.1.45635 WP_003091832.1.45636 WP_003091832.1.45678 WP_003091832.1.45700 WP_003091832.1.45711 WP_003091832.1.45723 WP_003091832.1.45818 WP_003091832.1.45837 WP_003091832.1.45920 WP_003091832.1.45934 WP_003091832.1.45946 WP_003091832.1.45961 WP_003091832.1.46010 WP_003091832.1.46032 WP_003091832.1.46093 WP_003091832.1.461 WP_003091832.1.46152 WP_003091832.1.46200 WP_003091832.1.46306 WP_003091832.1.4640 WP_003091832.1.46436 WP_003091832.1.46502 WP_003091832.1.46623 WP_003091832.1.46633 WP_003091832.1.46755 WP_003091832.1.46787 WP_003091832.1.46826 WP_003091832.1.46846 WP_003091832.1.46866 WP_003091832.1.46885 WP_003091832.1.46926 WP_003091832.1.46935 WP_003091832.1.47101 WP_003091832.1.47150 WP_003091832.1.47155 WP_003091832.1.47158 WP_003091832.1.47251 WP_003091832.1.4726 WP_003091832.1.47296 WP_003091832.1.47312 WP_003091832.1.47314 WP_003091832.1.47374 WP_003091832.1.47469 WP_003091832.1.47480 WP_003091832.1.47527 WP_003091832.1.47551 WP_003091832.1.47598 WP_003091832.1.47645 WP_003091832.1.47774 WP_003091832.1.47930 WP_003091832.1.47934 WP_003091832.1.47970 WP_003091832.1.48001 WP_003091832.1.48024 WP_003091832.1.48086 WP_003091832.1.48094 WP_003091832.1.48141 WP_003091832.1.48172 WP_003091832.1.48178 WP_003091832.1.48321 WP_003091832.1.48334 WP_003091832.1.4836 WP_003091832.1.48378 WP_003091832.1.48382 WP_003091832.1.48413 WP_003091832.1.48472 WP_003091832.1.48474 WP_003091832.1.48487 WP_003091832.1.48545 WP_003091832.1.48576 WP_003091832.1.48579 WP_003091832.1.48747 WP_003091832.1.48810 WP_003091832.1.48820 WP_003091832.1.48840 WP_003091832.1.48842 WP_003091832.1.48851 WP_003091832.1.48870 WP_003091832.1.48961 WP_003091832.1.49108 WP_003091832.1.4913 WP_003091832.1.49135 WP_003091832.1.49184 WP_003091832.1.49244 WP_003091832.1.49265 WP_003091832.1.49266 WP_003091832.1.49277 WP_003091832.1.49286 WP_003091832.1.49293 WP_003091832.1.49360 WP_003091832.1.49416 WP_003091832.1.49500 WP_003091832.1.49566 WP_003091832.1.49688 WP_003091832.1.49798 WP_003091832.1.49806 WP_003091832.1.49833 WP_003091832.1.49842 WP_003091832.1.49922 WP_003091832.1.49948 WP_003091832.1.49976 WP_003091832.1.49988 WP_003091832.1.49998 WP_003091832.1.50176 WP_003091832.1.50180 WP_003091832.1.50222 WP_003091832.1.50232 WP_003091832.1.50242 WP_003091832.1.5043 WP_003091832.1.50450 WP_003091832.1.50459 WP_003091832.1.50567 WP_003091832.1.50653 WP_003091832.1.50665 WP_003091832.1.50668 WP_003091832.1.50682 WP_003091832.1.50691 WP_003091832.1.50734 WP_003091832.1.50783 WP_003091832.1.50922 WP_003091832.1.50967 WP_003091832.1.50989 WP_003091832.1.51019 WP_003091832.1.51035 WP_003091832.1.51136 WP_003091832.1.51141 WP_003091832.1.51173 WP_003091832.1.51183 WP_003091832.1.51185 WP_003091832.1.51267 WP_003091832.1.51273 WP_003091832.1.5132 WP_003091832.1.51457 WP_003091832.1.51472 WP_003091832.1.51501 WP_003091832.1.51538 WP_003091832.1.51549 WP_003091832.1.51585 WP_003091832.1.51682 WP_003091832.1.51727 WP_003091832.1.51733 WP_003091832.1.51807 WP_003091832.1.51847 WP_003091832.1.51889 WP_003091832.1.51917 WP_003091832.1.51928 WP_003091832.1.51937 WP_003091832.1.51943 WP_003091832.1.51957 WP_003091832.1.51976 WP_003091832.1.52146 WP_003091832.1.52152 WP_003091832.1.52212 WP_003091832.1.52220 WP_003091832.1.52244 WP_003091832.1.5226 WP_003091832.1.52326 WP_003091832.1.52334 WP_003091832.1.5235 WP_003091832.1.52355 WP_003091832.1.52372 WP_003091832.1.52403 WP_003091832.1.52409 WP_003091832.1.52449 WP_003091832.1.52500 WP_003091832.1.52537 WP_003091832.1.5258 WP_003091832.1.52583 WP_003091832.1.52591 WP_003091832.1.5260 WP_003091832.1.52690 WP_003091832.1.52697 WP_003091832.1.52700 WP_003091832.1.52728 WP_003091832.1.52784 WP_003091832.1.52790 WP_003091832.1.52810 WP_003091832.1.52850 WP_003091832.1.5289 WP_003091832.1.52939 WP_003091832.1.5294 WP_003091832.1.53037 WP_003091832.1.53038 WP_003091832.1.53070 WP_003091832.1.53072 WP_003091832.1.53169 WP_003091832.1.53267 WP_003091832.1.53287 WP_003091832.1.53351 WP_003091832.1.53371 WP_003091832.1.53414 WP_003091832.1.53427 WP_003091832.1.53486 WP_003091832.1.53528 WP_003091832.1.53530 WP_003091832.1.53586 WP_003091832.1.53663 WP_003091832.1.53678 WP_003091832.1.53719 WP_003091832.1.53726 WP_003091832.1.53826 WP_003091832.1.5388 WP_003091832.1.53932 WP_003091832.1.53946 WP_003091832.1.53948 WP_003091832.1.53951 WP_003091832.1.5399 WP_003091832.1.54003 WP_003091832.1.54076 WP_003091832.1.54078 WP_003091832.1.54090 WP_003091832.1.54133 WP_003091832.1.54140 WP_003091832.1.54146 WP_003091832.1.5420 WP_003091832.1.54248 WP_003091832.1.5427 WP_003091832.1.54293 WP_003091832.1.54354 WP_003091832.1.54462 WP_003091832.1.54497 WP_003091832.1.54571 WP_003091832.1.54742 WP_003091832.1.54809 WP_003091832.1.54974 WP_003091832.1.55 WP_003091832.1.55089 WP_003091832.1.55169 WP_003091832.1.55318 WP_003091832.1.55347 WP_003091832.1.55387 WP_003091832.1.55400 WP_003091832.1.55445 WP_003091832.1.55478 WP_003091832.1.55543 WP_003091832.1.55729 WP_003091832.1.55813 WP_003091832.1.55976 WP_003091832.1.56013 WP_003091832.1.56037 WP_003091832.1.56145 WP_003091832.1.56171 WP_003091832.1.56187 WP_003091832.1.56188 WP_003091832.1.56196 WP_003091832.1.56228 WP_003091832.1.56229 WP_003091832.1.56315 WP_003091832.1.56348 WP_003091832.1.56442 WP_003091832.1.56452 WP_003091832.1.56465 WP_003091832.1.56474 WP_003091832.1.56475 WP_003091832.1.56626 WP_003091832.1.56632 WP_003091832.1.56745 WP_003091832.1.56768 WP_003091832.1.56797 WP_003091832.1.56808 WP_003091832.1.56819 WP_003091832.1.56837 WP_003091832.1.56864 WP_003091832.1.56896 WP_003091832.1.56973 WP_003091832.1.57005 WP_003091832.1.57020 WP_003091832.1.57065 WP_003091832.1.57113 WP_003091832.1.57131 WP_003091832.1.57140 WP_003091832.1.57276 WP_003091832.1.5731 WP_003091832.1.57339 WP_003091832.1.57369 WP_003091832.1.57417 WP_003091832.1.57460 WP_003091832.1.57477 WP_003091832.1.57480 WP_003091832.1.57532 WP_003091832.1.57548 WP_003091832.1.57566 WP_003091832.1.57728 WP_003091832.1.57792 WP_003091832.1.57839 WP_003091832.1.57841 WP_003091832.1.57853 WP_003091832.1.57921 WP_003091832.1.57966 WP_003091832.1.58019 WP_003091832.1.58056 WP_003091832.1.58155 WP_003091832.1.58162 WP_003091832.1.58183 WP_003091832.1.58193 WP_003091832.1.58200 WP_003091832.1.58228 WP_003091832.1.58294 WP_003091832.1.58360 WP_003091832.1.58417 WP_003091832.1.58436 WP_003091832.1.58482 WP_003091832.1.5850 WP_003091832.1.58510 WP_003091832.1.58527 WP_003091832.1.5856 WP_003091832.1.58581 WP_003091832.1.58689 WP_003091832.1.5869 WP_003091832.1.58785 WP_003091832.1.58800 WP_003091832.1.58838 WP_003091832.1.58845 WP_003091832.1.5889 WP_003091832.1.58944 WP_003091832.1.58952 WP_003091832.1.5897 WP_003091832.1.59013 WP_003091832.1.59076 WP_003091832.1.59099 WP_003091832.1.59123 WP_003091832.1.59156 WP_003091832.1.59158 WP_003091832.1.59176 WP_003091832.1.59212 WP_003091832.1.59246 WP_003091832.1.59249 WP_003091832.1.59250 WP_003091832.1.59288 WP_003091832.1.59339 WP_003091832.1.5937 WP_003091832.1.59376 WP_003091832.1.59385 WP_003091832.1.594 WP_003091832.1.59469 WP_003091832.1.59563 WP_003091832.1.59688 WP_003091832.1.59724 WP_003091832.1.59759 WP_003091832.1.59797 WP_003091832.1.59831 WP_003091832.1.59870 WP_003091832.1.59943 WP_003091832.1.60051 WP_003091832.1.60062 WP_003091832.1.60079 WP_003091832.1.60082 WP_003091832.1.60084 WP_003091832.1.60085 WP_003091832.1.60206 WP_003091832.1.60261 WP_003091832.1.60347 WP_003091832.1.60364 WP_003091832.1.60396 WP_003091832.1.60415 WP_003091832.1.60467 WP_003091832.1.60472 WP_003091832.1.60509 WP_003091832.1.60600 WP_003091832.1.60602 WP_003091832.1.60603 WP_003091832.1.60639 WP_003091832.1.60679 WP_003091832.1.60686 WP_003091832.1.607 WP_003091832.1.60850 WP_003091832.1.60910 WP_003091832.1.60916 WP_003091832.1.60970 WP_003091832.1.60979 WP_003091832.1.61122 WP_003091832.1.61130 WP_003091832.1.61191 WP_003091832.1.61209 WP_003091832.1.61222 WP_003091832.1.61269 WP_003091832.1.61288 WP_003091832.1.61294 WP_003091832.1.61299 WP_003091832.1.6130 WP_003091832.1.61366 WP_003091832.1.61431 WP_003091832.1.61493 WP_003091832.1.61549 WP_003091832.1.61589 WP_003091832.1.61598 WP_003091832.1.616 WP_003091832.1.61696 WP_003091832.1.6173 WP_003091832.1.61943 WP_003091832.1.62010 WP_003091832.1.62035 WP_003091832.1.62180 WP_003091832.1.62186 WP_003091832.1.62211 WP_003091832.1.62263 WP_003091832.1.62357 WP_003091832.1.62396 WP_003091832.1.62410 WP_003091832.1.6242 WP_003091832.1.62483 WP_003091832.1.62516 WP_003091832.1.62534 WP_003091832.1.626 WP_003091832.1.62604 WP_003091832.1.62635 WP_003091832.1.62688 WP_003091832.1.62701 WP_003091832.1.62703 WP_003091832.1.62704 WP_003091832.1.62708 WP_003091832.1.62716 WP_003091832.1.62768 WP_003091832.1.62772 WP_003091832.1.6280 WP_003091832.1.6283 WP_003091832.1.62834 WP_003091832.1.62838 WP_003091832.1.62873 WP_003091832.1.62917 WP_003091832.1.62961 WP_003091832.1.62977 WP_003091832.1.63038 WP_003091832.1.63041 WP_003091832.1.63057 WP_003091832.1.63124 WP_003091832.1.63193 WP_003091832.1.63196 WP_003091832.1.63338 WP_003091832.1.63369 WP_003091832.1.63401 WP_003091832.1.63591 WP_003091832.1.63597 WP_003091832.1.63634 WP_003091832.1.63659 WP_003091832.1.63739 WP_003091832.1.63784 WP_003091832.1.63929 WP_003091832.1.63941 WP_003091832.1.63995 WP_003091832.1.64139 WP_003091832.1.64155 WP_003091832.1.64198 WP_003091832.1.64212 WP_003091832.1.64309 WP_003091832.1.64329 WP_003091832.1.64340 WP_003091832.1.64433 WP_003091832.1.6450 WP_003091832.1.64544 WP_003091832.1.64591 WP_003091832.1.64603 WP_003091832.1.64605 WP_003091832.1.6461 WP_003091832.1.64611 WP_003091832.1.64726 WP_003091832.1.64748 WP_003091832.1.64799 WP_003091832.1.64807 WP_003091832.1.64854 WP_003091832.1.64862 WP_003091832.1.64880 WP_003091832.1.64885 WP_003091832.1.64886 WP_003091832.1.64983 WP_003091832.1.64984 WP_003091832.1.65066 WP_003091832.1.65092 WP_003091832.1.65095 WP_003091832.1.65099 WP_003091832.1.65145 WP_003091832.1.65196 WP_003091832.1.65197 WP_003091832.1.65227 WP_003091832.1.65237 WP_003091832.1.65247 WP_003091832.1.65285 WP_003091832.1.65304 WP_003091832.1.65312 WP_003091832.1.65316 WP_003091832.1.65334 WP_003091832.1.65335 WP_003091832.1.65337 WP_003091832.1.65457 WP_003091832.1.65478 WP_003091832.1.65549 WP_003091832.1.65588 WP_003091832.1.65632 WP_003091832.1.65642 WP_003091832.1.65679 WP_003091832.1.65740 WP_003091832.1.65819 WP_003091832.1.65867 WP_003091832.1.6589 WP_003091832.1.65926 WP_003091832.1.66062 WP_003091832.1.66088 WP_003091832.1.66155 WP_003091832.1.66165 WP_003091832.1.6627 WP_003091832.1.66277 WP_003091832.1.6629 WP_003091832.1.66345 WP_003091832.1.66348 WP_003091832.1.66364 WP_003091832.1.66371 WP_003091832.1.66410 WP_003091832.1.66526 WP_003091832.1.66563 WP_003091832.1.66634 WP_003091832.1.66693 WP_003091832.1.66721 WP_003091832.1.66892 WP_003091832.1.66929 WP_003091832.1.66931 WP_003091832.1.66945 WP_003091832.1.66950 WP_003091832.1.66982 WP_003091832.1.67010 WP_003091832.1.67124 WP_003091832.1.67188 WP_003091832.1.67192 WP_003091832.1.67205 WP_003091832.1.67261 WP_003091832.1.67269 WP_003091832.1.6734 WP_003091832.1.67370 WP_003091832.1.67388 WP_003091832.1.67472 WP_003091832.1.67489 WP_003091832.1.67506 WP_003091832.1.67526 WP_003091832.1.67531 WP_003091832.1.67545 WP_003091832.1.6768 WP_003091832.1.67686 WP_003091832.1.67755 WP_003091832.1.67830 WP_003091832.1.67874 WP_003091832.1.67875 WP_003091832.1.67899 WP_003091832.1.67903 WP_003091832.1.67937 WP_003091832.1.67948 WP_003091832.1.6796 WP_003091832.1.68000 WP_003091832.1.6808 WP_003091832.1.68158 WP_003091832.1.68162 WP_003091832.1.68172 WP_003091832.1.68183 WP_003091832.1.68194 WP_003091832.1.68252 WP_003091832.1.68317 WP_003091832.1.68446 WP_003091832.1.68448 WP_003091832.1.68472 WP_003091832.1.68499 WP_003091832.1.6850 WP_003091832.1.68541 WP_003091832.1.68561 WP_003091832.1.68568 WP_003091832.1.68638 WP_003091832.1.6866 WP_003091832.1.68756 WP_003091832.1.68781 WP_003091832.1.68790 WP_003091832.1.68800 WP_003091832.1.68802 WP_003091832.1.68850 WP_003091832.1.68857 WP_003091832.1.68862 WP_003091832.1.68910 WP_003091832.1.68938 WP_003091832.1.68979 WP_003091832.1.69088 WP_003091832.1.6911 WP_003091832.1.69159 WP_003091832.1.69209 WP_003091832.1.69260 WP_003091832.1.6928 WP_003091832.1.6931 WP_003091832.1.69330 WP_003091832.1.6937 WP_003091832.1.69411 WP_003091832.1.69534 WP_003091832.1.69556 WP_003091832.1.69599 WP_003091832.1.69702 WP_003091832.1.69788 WP_003091832.1.69791 WP_003091832.1.69819 WP_003091832.1.69834 WP_003091832.1.69907 WP_003091832.1.69993 WP_003091832.1.70092 WP_003091832.1.70098 WP_003091832.1.70138 WP_003091832.1.70168 WP_003091832.1.70194 WP_003091832.1.70216 WP_003091832.1.70229 WP_003091832.1.70331 WP_003091832.1.70460 WP_003091832.1.70470 WP_003091832.1.70537 WP_003091832.1.70583 WP_003091832.1.70648 WP_003091832.1.70650 WP_003091832.1.70670 WP_003091832.1.70677 WP_003091832.1.70693 WP_003091832.1.7077 WP_003091832.1.70778 WP_003091832.1.70831 WP_003091832.1.70991 WP_003091832.1.71038 WP_003091832.1.71141 WP_003091832.1.71203 WP_003091832.1.71234 WP_003091832.1.71249 WP_003091832.1.71254 WP_003091832.1.7128 WP_003091832.1.71290 WP_003091832.1.71346 WP_003091832.1.71385 WP_003091832.1.71412 WP_003091832.1.71570 WP_003091832.1.71610 WP_003091832.1.7163 WP_003091832.1.71642 WP_003091832.1.71666 WP_003091832.1.71738 WP_003091832.1.71799 WP_003091832.1.71806 WP_003091832.1.71822 WP_003091832.1.71862 WP_003091832.1.71866 WP_003091832.1.71891 WP_003091832.1.71927 WP_003091832.1.72149 WP_003091832.1.72167 WP_003091832.1.72181 WP_003091832.1.72183 WP_003091832.1.7219 WP_003091832.1.72287 WP_003091832.1.72323 WP_003091832.1.72331 WP_003091832.1.72346 WP_003091832.1.72378 WP_003091832.1.72447 WP_003091832.1.72458 WP_003091832.1.72477 WP_003091832.1.72541 WP_003091832.1.72562 WP_003091832.1.72570 WP_003091832.1.72653 WP_003091832.1.72662 WP_003091832.1.72669 WP_003091832.1.72727 WP_003091832.1.7276 WP_003091832.1.72768 WP_003091832.1.72772 WP_003091832.1.72782 WP_003091832.1.72845 WP_003091832.1.72920 WP_003091832.1.73035 WP_003091832.1.73048 WP_003091832.1.7308 WP_003091832.1.73135 WP_003091832.1.73149 WP_003091832.1.73172 WP_003091832.1.73192 WP_003091832.1.7327 WP_003091832.1.7329 WP_003091832.1.733 WP_003091832.1.73455 WP_003091832.1.73490 WP_003091832.1.73523 WP_003091832.1.73541 WP_003091832.1.73601 WP_003091832.1.73651 WP_003091832.1.73719 WP_003091832.1.73728 WP_003091832.1.73791 WP_003091832.1.7382 WP_003091832.1.73860 WP_003091832.1.73889 WP_003091832.1.73911 WP_003091832.1.74 WP_003091832.1.74000 WP_003091832.1.74072 WP_003091832.1.74074 WP_003091832.1.7408 WP_003091832.1.74106 WP_003091832.1.74167 WP_003091832.1.74175 WP_003091832.1.74180 WP_003091832.1.74219 WP_003091832.1.74264 WP_003091832.1.74268 WP_003091832.1.74281 WP_003091832.1.74287 WP_003091832.1.74326 WP_003091832.1.7445 WP_003091832.1.74458 WP_003091832.1.74473 WP_003091832.1.74475 WP_003091832.1.7448 WP_003091832.1.74518 WP_003091832.1.7456 WP_003091832.1.74568 WP_003091832.1.74604 WP_003091832.1.74629 WP_003091832.1.74637 WP_003091832.1.74685 WP_003091832.1.74772 WP_003091832.1.74776 WP_003091832.1.748 WP_003091832.1.74878 WP_003091832.1.74941 WP_003091832.1.74948 WP_003091832.1.74958 WP_003091832.1.7501 WP_003091832.1.75041 WP_003091832.1.75119 WP_003091832.1.75204 WP_003091832.1.75277 WP_003091832.1.75303 WP_003091832.1.75389 WP_003091832.1.75431 WP_003091832.1.7547 WP_003091832.1.75549 WP_003091832.1.75573 WP_003091832.1.75580 WP_003091832.1.75599 WP_003091832.1.75603 WP_003091832.1.75631 WP_003091832.1.7568 WP_003091832.1.75756 WP_003091832.1.75771 WP_003091832.1.75792 WP_003091832.1.75825 WP_003091832.1.75826 WP_003091832.1.75860 WP_003091832.1.75935 WP_003091832.1.75938 WP_003091832.1.75947 WP_003091832.1.7595 WP_003091832.1.76077 WP_003091832.1.76092 WP_003091832.1.76141 WP_003091832.1.76145 WP_003091832.1.76192 WP_003091832.1.76322 WP_003091832.1.76355 WP_003091832.1.76383 WP_003091832.1.76399 WP_003091832.1.76441 WP_003091832.1.76467 WP_003091832.1.76484 WP_003091832.1.76543 WP_003091832.1.76600 WP_003091832.1.76633 WP_003091832.1.7666 WP_003091832.1.76716 WP_003091832.1.76775 WP_003091832.1.76791 WP_003091832.1.76861 WP_003091832.1.76922 WP_003091832.1.76985 WP_003091832.1.77235 WP_003091832.1.77286 WP_003091832.1.77317 WP_003091832.1.77442 WP_003091832.1.77476 WP_003091832.1.77490 WP_003091832.1.77566 WP_003091832.1.77574 WP_003091832.1.77587 WP_003091832.1.77686 WP_003091832.1.77750 WP_003091832.1.77769 WP_003091832.1.7779 WP_003091832.1.77819 WP_003091832.1.77834 WP_003091832.1.77913 WP_003091832.1.78104 WP_003091832.1.78112 WP_003091832.1.78118 WP_003091832.1.78134 WP_003091832.1.78148 WP_003091832.1.78158 WP_003091832.1.78280 WP_003091832.1.78288 WP_003091832.1.78380 WP_003091832.1.7840 WP_003091832.1.78409 WP_003091832.1.78425 WP_003091832.1.78430 WP_003091832.1.78437 WP_003091832.1.78570 WP_003091832.1.78599 WP_003091832.1.78623 WP_003091832.1.78669 WP_003091832.1.78693 WP_003091832.1.78795 WP_003091832.1.788 WP_003091832.1.78810 WP_003091832.1.78926 WP_003091832.1.78947 WP_003091832.1.78954 WP_003091832.1.78986 WP_003091832.1.7899 WP_003091832.1.79003 WP_003091832.1.79007 WP_003091832.1.79053 WP_003091832.1.79060 WP_003091832.1.79177 WP_003091832.1.79193 WP_003091832.1.79256 WP_003091832.1.79279 WP_003091832.1.79286 WP_003091832.1.79311 WP_003091832.1.79357 WP_003091832.1.79364 WP_003091832.1.79421 WP_003091832.1.79429 WP_003091832.1.79431 WP_003091832.1.7945 WP_003091832.1.79463 WP_003091832.1.79507 WP_003091832.1.7953 WP_003091832.1.79544 WP_003091832.1.79569 WP_003091832.1.79601 WP_003091832.1.79631 WP_003091832.1.79699 WP_003091832.1.79754 WP_003091832.1.79788 WP_003091832.1.79862 WP_003091832.1.79883 WP_003091832.1.799 WP_003091832.1.79902 WP_003091832.1.79908 WP_003091832.1.79986 WP_003091832.1.8 WP_003091832.1.80033 WP_003091832.1.80068 WP_003091832.1.80087 WP_003091832.1.80102 WP_003091832.1.8013 WP_003091832.1.80174 WP_003091832.1.8028 WP_003091832.1.80306 WP_003091832.1.8038 WP_003091832.1.80410 WP_003091832.1.80411 WP_003091832.1.80454 WP_003091832.1.80481 WP_003091832.1.8051 WP_003091832.1.80535 WP_003091832.1.80572 WP_003091832.1.80627 WP_003091832.1.80632 WP_003091832.1.8064 WP_003091832.1.80644 WP_003091832.1.80645 WP_003091832.1.80683 WP_003091832.1.80715 WP_003091832.1.80720 WP_003091832.1.80785 WP_003091832.1.80846 WP_003091832.1.80880 WP_003091832.1.80910 WP_003091832.1.80926 WP_003091832.1.80929 WP_003091832.1.80931 WP_003091832.1.80938 WP_003091832.1.80969 WP_003091832.1.81081 WP_003091832.1.81082 WP_003091832.1.8110 WP_003091832.1.81206 WP_003091832.1.81237 WP_003091832.1.81331 WP_003091832.1.81338 WP_003091832.1.81349 WP_003091832.1.81368 WP_003091832.1.81380 WP_003091832.1.8141 WP_003091832.1.81426 WP_003091832.1.81470 WP_003091832.1.81482 WP_003091832.1.81487 WP_003091832.1.81581 WP_003091832.1.81591 WP_003091832.1.81622 WP_003091832.1.81643 WP_003091832.1.81708 WP_003091832.1.81728 WP_003091832.1.81742 WP_003091832.1.81748 WP_003091832.1.81771 WP_003091832.1.81784 WP_003091832.1.81802 WP_003091832.1.81834 WP_003091832.1.81844 WP_003091832.1.81856 WP_003091832.1.81874 WP_003091832.1.81927 WP_003091832.1.81950 WP_003091832.1.81957 WP_003091832.1.81960 WP_003091832.1.81986 WP_003091832.1.82117 WP_003091832.1.82127 WP_003091832.1.82178 WP_003091832.1.82260 WP_003091832.1.8227 WP_003091832.1.82310 WP_003091832.1.82312 WP_003091832.1.82328 WP_003091832.1.82334 WP_003091832.1.8238 WP_003091832.1.82442 WP_003091832.1.82487 WP_003091832.1.82580 WP_003091832.1.82604 WP_003091832.1.82606 WP_003091832.1.82620 WP_003091832.1.82643 WP_003091832.1.82686 WP_003091832.1.82710 WP_003091832.1.82798 WP_003091832.1.82810 WP_003091832.1.8284 WP_003091832.1.82864 WP_003091832.1.82882 WP_003091832.1.82887 WP_003091832.1.82936 WP_003091832.1.83025 WP_003091832.1.83131 WP_003091832.1.83184 WP_003091832.1.83213 WP_003091832.1.83251 WP_003091832.1.83267 WP_003091832.1.83296 WP_003091832.1.83317 WP_003091832.1.83374 WP_003091832.1.83394 WP_003091832.1.83440 WP_003091832.1.83460 WP_003091832.1.83463 WP_003091832.1.835 WP_003091832.1.83503 WP_003091832.1.8351 WP_003091832.1.8353 WP_003091832.1.83534 WP_003091832.1.83540 WP_003091832.1.8357 WP_003091832.1.83637 WP_003091832.1.83673 WP_003091832.1.83698 WP_003091832.1.83715 WP_003091832.1.83871 WP_003091832.1.83937 WP_003091832.1.83946 WP_003091832.1.84003 WP_003091832.1.84008 WP_003091832.1.84138 WP_003091832.1.84162 WP_003091832.1.84174 WP_003091832.1.84177 WP_003091832.1.84178 WP_003091832.1.84190 WP_003091832.1.84203 WP_003091832.1.84271 WP_003091832.1.84297 WP_003091832.1.8437 WP_003091832.1.84374 WP_003091832.1.84398 WP_003091832.1.84404 WP_003091832.1.84439 WP_003091832.1.84471 WP_003091832.1.84487 WP_003091832.1.84526 WP_003091832.1.8453 WP_003091832.1.84538 WP_003091832.1.84558 WP_003091832.1.84589 WP_003091832.1.84674 WP_003091832.1.84684 WP_003091832.1.84702 WP_003091832.1.84715 WP_003091832.1.84754 WP_003091832.1.84792 WP_003091832.1.84825 WP_003091832.1.8484 WP_003091832.1.84865 WP_003091832.1.84937 WP_003091832.1.84946 WP_003091832.1.8498 WP_003091832.1.85018 WP_003091832.1.85028 WP_003091832.1.85059 WP_003091832.1.85150 WP_003091832.1.85220 WP_003091832.1.85290 WP_003091832.1.85298 WP_003091832.1.85303 WP_003091832.1.85311 WP_003091832.1.85318 WP_003091832.1.85357 WP_003091832.1.85446 WP_003091832.1.85453 WP_003091832.1.85574 WP_003091832.1.85633 WP_003091832.1.85638 WP_003091832.1.85788 WP_003091832.1.85897 WP_003091832.1.85910 WP_003091832.1.85920 WP_003091832.1.85978 WP_003091832.1.86002 WP_003091832.1.86047 WP_003091832.1.86055 WP_003091832.1.86058 WP_003091832.1.861 WP_003091832.1.86125 WP_003091832.1.86182 WP_003091832.1.86243 WP_003091832.1.86278 WP_003091832.1.86287 WP_003091832.1.86293 WP_003091832.1.86386 WP_003091832.1.86432 WP_003091832.1.8645 WP_003091832.1.865 WP_003091832.1.86506 WP_003091832.1.86545 WP_003091832.1.86552 WP_003091832.1.86554 WP_003091832.1.86595 WP_003091832.1.86652 WP_003091832.1.86665 WP_003091832.1.867 WP_003091832.1.86708 WP_003091832.1.86733 WP_003091832.1.86774 WP_003091832.1.86780 WP_003091832.1.86785 WP_003091832.1.86796 WP_003091832.1.86813 WP_003091832.1.86822 WP_003091832.1.8693 WP_003091832.1.86947 WP_003091832.1.86970 WP_003091832.1.86985 WP_003091832.1.87104 WP_003091832.1.87163 WP_003091832.1.8718 WP_003091832.1.87182 WP_003091832.1.87183 WP_003091832.1.8727 WP_003091832.1.87316 WP_003091832.1.87390 WP_003091832.1.87435 WP_003091832.1.87463 WP_003091832.1.8749 WP_003091832.1.87530 WP_003091832.1.87547 WP_003091832.1.87648 WP_003091832.1.87763 WP_003091832.1.8777 WP_003091832.1.8785 WP_003091832.1.87877 WP_003091832.1.87888 WP_003091832.1.87970 WP_003091832.1.87975 WP_003091832.1.87981 WP_003091832.1.87987 WP_003091832.1.88004 WP_003091832.1.88152 WP_003091832.1.88308 WP_003091832.1.88330 WP_003091832.1.88360 WP_003091832.1.88388 WP_003091832.1.88415 WP_003091832.1.88517 WP_003091832.1.8852 WP_003091832.1.88540 WP_003091832.1.88550 WP_003091832.1.88578 WP_003091832.1.88605 WP_003091832.1.88659 WP_003091832.1.88679 WP_003091832.1.88680 WP_003091832.1.88714 WP_003091832.1.88750 WP_003091832.1.88796 WP_003091832.1.889 WP_003091832.1.88900 WP_003091832.1.88949 WP_003091832.1.88969 WP_003091832.1.89083 WP_003091832.1.89098 WP_003091832.1.8911 WP_003091832.1.89234 WP_003091832.1.89245 WP_003091832.1.89266 WP_003091832.1.89276 WP_003091832.1.89330 WP_003091832.1.89409 WP_003091832.1.89434 WP_003091832.1.89440 WP_003091832.1.89480 WP_003091832.1.8949 WP_003091832.1.89491 WP_003091832.1.89523 WP_003091832.1.89577 WP_003091832.1.89610 WP_003091832.1.89638 WP_003091832.1.89662 WP_003091832.1.89669 WP_003091832.1.89736 WP_003091832.1.8976 WP_003091832.1.89776 WP_003091832.1.89805 WP_003091832.1.89866 WP_003091832.1.89867 WP_003091832.1.89868 WP_003091832.1.89871 WP_003091832.1.89886 WP_003091832.1.89992 WP_003091832.1.90024 WP_003091832.1.90032 WP_003091832.1.90056 WP_003091832.1.90110 WP_003091832.1.90141 WP_003091832.1.90150 WP_003091832.1.90189 WP_003091832.1.90224 WP_003091832.1.90225 WP_003091832.1.90242 WP_003091832.1.90268 WP_003091832.1.90272 WP_003091832.1.90306 WP_003091832.1.90412 WP_003091832.1.9056 WP_003091832.1.90569 WP_003091832.1.90655 WP_003091832.1.90770 WP_003091832.1.90940 WP_003091832.1.90999 WP_003091832.1.91012 WP_003091832.1.91093 WP_003091832.1.91161 WP_003091832.1.9120 WP_003091832.1.91204 WP_003091832.1.91236 WP_003091832.1.91281 WP_003091832.1.91307 WP_003091832.1.91336 WP_003091832.1.91360 WP_003091832.1.91392 WP_003091832.1.91416 WP_003091832.1.9143 WP_003091832.1.91431 WP_003091832.1.91438 WP_003091832.1.91467 WP_003091832.1.91527 WP_003091832.1.91563 WP_003091832.1.91585 WP_003091832.1.91796 WP_003091832.1.91803 WP_003091832.1.9182 WP_003091832.1.91838 WP_003091832.1.91846 WP_003091832.1.91860 WP_003091832.1.91862 WP_003091832.1.91882 WP_003091832.1.9191 WP_003091832.1.91938 WP_003091832.1.91943 WP_003091832.1.91996 WP_003091832.1.92043 WP_003091832.1.92175 WP_003091832.1.9219 WP_003091832.1.92314 WP_003091832.1.92321 WP_003091832.1.92357 WP_003091832.1.92454 WP_003091832.1.92573 WP_003091832.1.92585 WP_003091832.1.92587 WP_003091832.1.92589 WP_003091832.1.92594 WP_003091832.1.92624 WP_003091832.1.92630 WP_003091832.1.92642 WP_003091832.1.9272 WP_003091832.1.92759 WP_003091832.1.92769 WP_003091832.1.92839 WP_003091832.1.92847 WP_003091832.1.92894 WP_003091832.1.92924 WP_003091832.1.92930 WP_003091832.1.93001 WP_003091832.1.93090 WP_003091832.1.93122 WP_003091832.1.93130 WP_003091832.1.93144 WP_003091832.1.93148 WP_003091832.1.93250 WP_003091832.1.93264 WP_003091832.1.9328 WP_003091832.1.93446 WP_003091832.1.9349 WP_003091832.1.93493 WP_003091832.1.93498 WP_003091832.1.93520 WP_003091832.1.93547 WP_003091832.1.93562 WP_003091832.1.93568 WP_003091832.1.93797 WP_003091832.1.93848 WP_003091832.1.93889 WP_003091832.1.93897 WP_003091832.1.94004 WP_003091832.1.94031 WP_003091832.1.94065 WP_003091832.1.94078 WP_003091832.1.94136 WP_003091832.1.94174 WP_003091832.1.94211 WP_003091832.1.94218 WP_003091832.1.94221 WP_003091832.1.94230 WP_003091832.1.94243 WP_003091832.1.94285 WP_003091832.1.94288 WP_003091832.1.94333 WP_003091832.1.94349 WP_003091832.1.94385 WP_003091832.1.94422 WP_003091832.1.94434 WP_003091832.1.9444 WP_003091832.1.94450 WP_003091832.1.94682 WP_003091832.1.94732 WP_003091832.1.94742 WP_003091832.1.94814 WP_003091832.1.94818 WP_003091832.1.94856 WP_003091832.1.94874 WP_003091832.1.94881 WP_003091832.1.94896 WP_003091832.1.94897 WP_003091832.1.94943 WP_003091832.1.95018 WP_003091832.1.95025 WP_003091832.1.95027 WP_003091832.1.95056 WP_003091832.1.95117 WP_003091832.1.95132 WP_003091832.1.95187 WP_003091832.1.95207 WP_003091832.1.95217 WP_003091832.1.95305 WP_003091832.1.95324 WP_003091832.1.95354 WP_003091832.1.95359 WP_003091832.1.95460 WP_003091832.1.95525 WP_003091832.1.95536 WP_003091832.1.95638 WP_003091832.1.95668 WP_003091832.1.95751 WP_003091832.1.95774 WP_003091832.1.95782 WP_003091832.1.95787 WP_003091832.1.95802 WP_003091832.1.95820 WP_003091832.1.95825 WP_003091832.1.95959 WP_003091832.1.9599 WP_003091832.1.95994 WP_003091832.1.95999 WP_003091832.1.96008 WP_003091832.1.9604 WP_003091832.1.96041 WP_003091832.1.96058 WP_003091832.1.961 WP_003091832.1.96134 WP_003091832.1.96193 WP_003091832.1.96243 WP_003091832.1.96267 WP_003091832.1.96357 WP_003091832.1.96384 WP_003091832.1.96434 WP_003091832.1.96452 WP_003091832.1.96506 WP_003091832.1.96667 WP_003091832.1.96702 WP_003091832.1.96714 WP_003091832.1.96863 WP_003091832.1.96880 WP_003091832.1.96967 WP_003091832.1.9706 WP_003091832.1.97118 WP_003091832.1.97126 WP_003091832.1.97204 WP_003091832.1.97213 WP_003091832.1.9722 WP_003091832.1.97271 WP_003091832.1.97272 WP_003091832.1.97377 WP_003091832.1.97461 WP_003091832.1.97474 WP_003091832.1.97488 WP_003091832.1.97499 WP_003091832.1.97503 WP_003091832.1.97521 WP_003091832.1.97583 WP_003091832.1.97614 WP_003091832.1.977 WP_003091832.1.97784 WP_003091832.1.97826 WP_003091832.1.97877 WP_003091832.1.97968 WP_003091832.1.98111 WP_003091832.1.98260 WP_003091832.1.98276 WP_003091832.1.98308 WP_003091832.1.98410 WP_003091832.1.98414 WP_003091832.1.98433 WP_003091832.1.9845 WP_003091832.1.985 WP_003091832.1.98515 WP_003091832.1.98522 WP_003091832.1.98573 WP_003091832.1.98600 WP_003091832.1.98610 WP_003091832.1.98672 WP_003091832.1.98678 WP_003091832.1.98693 WP_003091832.1.98718 WP_003091832.1.98788 WP_003091832.1.98814 WP_003091832.1.9885 WP_003091832.1.98873 WP_003091832.1.98907 WP_003091832.1.98926 WP_003091832.1.98958 WP_003091832.1.98960 WP_003091832.1.98963 WP_003091832.1.99065 WP_003091832.1.99068 WP_003091832.1.99103 WP_003091832.1.99214 WP_003091832.1.99293 WP_003091832.1.99353 WP_003091832.1.99386 WP_003091832.1.99389 WP_003091832.1.99443 WP_003091832.1.99461 WP_003091832.1.99516 WP_003091832.1.99647 WP_003091832.1.99654 WP_003091832.1.99662 WP_003091832.1.99746 WP_003091832.1.99757 WP_003091832.1.99772 WP_003091832.1.99795 WP_003091832.1.99835 WP_003091832.1.9989 WP_003091832.1.99930 gi|564951449|ref|YP_008884019.1| gi|514410620|ref|YP_008134035.1| gi|558673525|ref|YP_008810233.1| gi|558667174|ref|YP_008803884.1| gi|568152810|ref|YP_008941764.1| gi|218890404|ref|YP_002439268.1| gi|478477744|ref|YP_007708395.1| gi|15598593|ref|NP_252087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]