SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153167|ref|YP_008942128.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153167|ref|YP_008942128.1|
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 71-194
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.55e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568153167|ref|YP_008942128.1|
Sequence length 198
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MKLHDLDLSGNAYKVRLFLSLIGREATLRPVDFLNREHKTQAFLRMNPRGQIPVLEDGEL
QLGDSHAILVYLARRHAGPEWYPLDPVSQGRIAYWLSYSANEVQNGPASARLITRFNLPL
DREQTHQRGLEVLRLVDRHLAEHRWLAQGEQPSIADVALYPYLALAPEGGLALDHYPALN
AWIARIRALPGYIPMPGL
Download sequence
Identical sequences A0A069QJY6 A0A1E9CKJ2 A0A1G5DQ17 A0A1S1C5V0
WP_003116471.1.100071 WP_003116471.1.100100 WP_003116471.1.100276 WP_003116471.1.100420 WP_003116471.1.100456 WP_003116471.1.100473 WP_003116471.1.100523 WP_003116471.1.100742 WP_003116471.1.100808 WP_003116471.1.100810 WP_003116471.1.100983 WP_003116471.1.100995 WP_003116471.1.101090 WP_003116471.1.101340 WP_003116471.1.101712 WP_003116471.1.101739 WP_003116471.1.101809 WP_003116471.1.101819 WP_003116471.1.101871 WP_003116471.1.10201 WP_003116471.1.10202 WP_003116471.1.10204 WP_003116471.1.102045 WP_003116471.1.10228 WP_003116471.1.1037 WP_003116471.1.10457 WP_003116471.1.10482 WP_003116471.1.10529 WP_003116471.1.10572 WP_003116471.1.10636 WP_003116471.1.10641 WP_003116471.1.11026 WP_003116471.1.11058 WP_003116471.1.1107 WP_003116471.1.11077 WP_003116471.1.11163 WP_003116471.1.11178 WP_003116471.1.11410 WP_003116471.1.11417 WP_003116471.1.11454 WP_003116471.1.11653 WP_003116471.1.11744 WP_003116471.1.11754 WP_003116471.1.1180 WP_003116471.1.11847 WP_003116471.1.1187 WP_003116471.1.11943 WP_003116471.1.12018 WP_003116471.1.12120 WP_003116471.1.12208 WP_003116471.1.12240 WP_003116471.1.12354 WP_003116471.1.1238 WP_003116471.1.12482 WP_003116471.1.12497 WP_003116471.1.12530 WP_003116471.1.12561 WP_003116471.1.12687 WP_003116471.1.12797 WP_003116471.1.12838 WP_003116471.1.12873 WP_003116471.1.12891 WP_003116471.1.12934 WP_003116471.1.12970 WP_003116471.1.12980 WP_003116471.1.13 WP_003116471.1.1305 WP_003116471.1.13057 WP_003116471.1.13208 WP_003116471.1.13232 WP_003116471.1.1333 WP_003116471.1.13407 WP_003116471.1.13529 WP_003116471.1.1356 WP_003116471.1.1362 WP_003116471.1.13622 WP_003116471.1.13758 WP_003116471.1.13765 WP_003116471.1.13795 WP_003116471.1.1393 WP_003116471.1.14378 WP_003116471.1.14424 WP_003116471.1.14564 WP_003116471.1.14714 WP_003116471.1.1475 WP_003116471.1.14820 WP_003116471.1.14835 WP_003116471.1.14839 WP_003116471.1.15004 WP_003116471.1.152 WP_003116471.1.15222 WP_003116471.1.15231 WP_003116471.1.15281 WP_003116471.1.15373 WP_003116471.1.15379 WP_003116471.1.15474 WP_003116471.1.15480 WP_003116471.1.15485 WP_003116471.1.15602 WP_003116471.1.15692 WP_003116471.1.15886 WP_003116471.1.15889 WP_003116471.1.15934 WP_003116471.1.16041 WP_003116471.1.16109 WP_003116471.1.16142 WP_003116471.1.16197 WP_003116471.1.162 WP_003116471.1.16239 WP_003116471.1.16242 WP_003116471.1.16419 WP_003116471.1.1646 WP_003116471.1.16694 WP_003116471.1.1670 WP_003116471.1.1671 WP_003116471.1.16788 WP_003116471.1.16801 WP_003116471.1.16808 WP_003116471.1.17155 WP_003116471.1.17162 WP_003116471.1.17353 WP_003116471.1.17354 WP_003116471.1.17370 WP_003116471.1.1739 WP_003116471.1.17566 WP_003116471.1.17697 WP_003116471.1.17883 WP_003116471.1.17890 WP_003116471.1.18117 WP_003116471.1.18199 WP_003116471.1.1824 WP_003116471.1.18735 WP_003116471.1.18930 WP_003116471.1.190 WP_003116471.1.19260 WP_003116471.1.19269 WP_003116471.1.19376 WP_003116471.1.19552 WP_003116471.1.19591 WP_003116471.1.19703 WP_003116471.1.1971 WP_003116471.1.19711 WP_003116471.1.19741 WP_003116471.1.19771 WP_003116471.1.19931 WP_003116471.1.20024 WP_003116471.1.20125 WP_003116471.1.20134 WP_003116471.1.20682 WP_003116471.1.20744 WP_003116471.1.20764 WP_003116471.1.20884 WP_003116471.1.209 WP_003116471.1.21242 WP_003116471.1.21349 WP_003116471.1.21358 WP_003116471.1.21448 WP_003116471.1.21469 WP_003116471.1.21517 WP_003116471.1.21607 WP_003116471.1.21718 WP_003116471.1.2172 WP_003116471.1.21767 WP_003116471.1.21863 WP_003116471.1.21871 WP_003116471.1.21891 WP_003116471.1.21932 WP_003116471.1.22078 WP_003116471.1.221 WP_003116471.1.22324 WP_003116471.1.22365 WP_003116471.1.22389 WP_003116471.1.22394 WP_003116471.1.22442 WP_003116471.1.22477 WP_003116471.1.22573 WP_003116471.1.22729 WP_003116471.1.22863 WP_003116471.1.2289 WP_003116471.1.22891 WP_003116471.1.23013 WP_003116471.1.23195 WP_003116471.1.23394 WP_003116471.1.23418 WP_003116471.1.23512 WP_003116471.1.23523 WP_003116471.1.23525 WP_003116471.1.23559 WP_003116471.1.23581 WP_003116471.1.23611 WP_003116471.1.23641 WP_003116471.1.23715 WP_003116471.1.23782 WP_003116471.1.23794 WP_003116471.1.23884 WP_003116471.1.23961 WP_003116471.1.24066 WP_003116471.1.24077 WP_003116471.1.24087 WP_003116471.1.24101 WP_003116471.1.24351 WP_003116471.1.24447 WP_003116471.1.2453 WP_003116471.1.24662 WP_003116471.1.2477 WP_003116471.1.24851 WP_003116471.1.24862 WP_003116471.1.24869 WP_003116471.1.24938 WP_003116471.1.25052 WP_003116471.1.25075 WP_003116471.1.251 WP_003116471.1.25109 WP_003116471.1.2511 WP_003116471.1.25142 WP_003116471.1.25149 WP_003116471.1.25179 WP_003116471.1.25271 WP_003116471.1.25348 WP_003116471.1.2535 WP_003116471.1.25532 WP_003116471.1.25695 WP_003116471.1.25964 WP_003116471.1.26025 WP_003116471.1.26042 WP_003116471.1.261 WP_003116471.1.26159 WP_003116471.1.26428 WP_003116471.1.26463 WP_003116471.1.2652 WP_003116471.1.26539 WP_003116471.1.26592 WP_003116471.1.26681 WP_003116471.1.26682 WP_003116471.1.26705 WP_003116471.1.26740 WP_003116471.1.26816 WP_003116471.1.26841 WP_003116471.1.26906 WP_003116471.1.26967 WP_003116471.1.2698 WP_003116471.1.27018 WP_003116471.1.27028 WP_003116471.1.27211 WP_003116471.1.27259 WP_003116471.1.27505 WP_003116471.1.27534 WP_003116471.1.27575 WP_003116471.1.27587 WP_003116471.1.27687 WP_003116471.1.27738 WP_003116471.1.27783 WP_003116471.1.27837 WP_003116471.1.27858 WP_003116471.1.27966 WP_003116471.1.28006 WP_003116471.1.28057 WP_003116471.1.28258 WP_003116471.1.28329 WP_003116471.1.28372 WP_003116471.1.28382 WP_003116471.1.28404 WP_003116471.1.28468 WP_003116471.1.28528 WP_003116471.1.28560 WP_003116471.1.28838 WP_003116471.1.28849 WP_003116471.1.28920 WP_003116471.1.29062 WP_003116471.1.29096 WP_003116471.1.29137 WP_003116471.1.29179 WP_003116471.1.29208 WP_003116471.1.29401 WP_003116471.1.2941 WP_003116471.1.29438 WP_003116471.1.29472 WP_003116471.1.29481 WP_003116471.1.29498 WP_003116471.1.29577 WP_003116471.1.2961 WP_003116471.1.29753 WP_003116471.1.29767 WP_003116471.1.29848 WP_003116471.1.30081 WP_003116471.1.30120 WP_003116471.1.30254 WP_003116471.1.30365 WP_003116471.1.30567 WP_003116471.1.30614 WP_003116471.1.30707 WP_003116471.1.30886 WP_003116471.1.30973 WP_003116471.1.31076 WP_003116471.1.31087 WP_003116471.1.31103 WP_003116471.1.31105 WP_003116471.1.31138 WP_003116471.1.31147 WP_003116471.1.31279 WP_003116471.1.31361 WP_003116471.1.31501 WP_003116471.1.31741 WP_003116471.1.3179 WP_003116471.1.32134 WP_003116471.1.32137 WP_003116471.1.32144 WP_003116471.1.32289 WP_003116471.1.32314 WP_003116471.1.32447 WP_003116471.1.32544 WP_003116471.1.32596 WP_003116471.1.32637 WP_003116471.1.32641 WP_003116471.1.32711 WP_003116471.1.32879 WP_003116471.1.33133 WP_003116471.1.33152 WP_003116471.1.33210 WP_003116471.1.33216 WP_003116471.1.33340 WP_003116471.1.33387 WP_003116471.1.33521 WP_003116471.1.33549 WP_003116471.1.33653 WP_003116471.1.33658 WP_003116471.1.33733 WP_003116471.1.33734 WP_003116471.1.3376 WP_003116471.1.33774 WP_003116471.1.34000 WP_003116471.1.34136 WP_003116471.1.34306 WP_003116471.1.34317 WP_003116471.1.34401 WP_003116471.1.34402 WP_003116471.1.34472 WP_003116471.1.34670 WP_003116471.1.34689 WP_003116471.1.34784 WP_003116471.1.34821 WP_003116471.1.34832 WP_003116471.1.34836 WP_003116471.1.34837 WP_003116471.1.34876 WP_003116471.1.34878 WP_003116471.1.34901 WP_003116471.1.35036 WP_003116471.1.35149 WP_003116471.1.35231 WP_003116471.1.3531 WP_003116471.1.35573 WP_003116471.1.35641 WP_003116471.1.35669 WP_003116471.1.35679 WP_003116471.1.35682 WP_003116471.1.3576 WP_003116471.1.35762 WP_003116471.1.35768 WP_003116471.1.35843 WP_003116471.1.35857 WP_003116471.1.35872 WP_003116471.1.35984 WP_003116471.1.36170 WP_003116471.1.36266 WP_003116471.1.36378 WP_003116471.1.36435 WP_003116471.1.36521 WP_003116471.1.36587 WP_003116471.1.36630 WP_003116471.1.36879 WP_003116471.1.37125 WP_003116471.1.37163 WP_003116471.1.3721 WP_003116471.1.37216 WP_003116471.1.37366 WP_003116471.1.37500 WP_003116471.1.37814 WP_003116471.1.37842 WP_003116471.1.3785 WP_003116471.1.38102 WP_003116471.1.38146 WP_003116471.1.38151 WP_003116471.1.3821 WP_003116471.1.3833 WP_003116471.1.38337 WP_003116471.1.38450 WP_003116471.1.38502 WP_003116471.1.38583 WP_003116471.1.38661 WP_003116471.1.38889 WP_003116471.1.38971 WP_003116471.1.39088 WP_003116471.1.39122 WP_003116471.1.39186 WP_003116471.1.39271 WP_003116471.1.39326 WP_003116471.1.39345 WP_003116471.1.3943 WP_003116471.1.39444 WP_003116471.1.39452 WP_003116471.1.39786 WP_003116471.1.39949 WP_003116471.1.39989 WP_003116471.1.40135 WP_003116471.1.40207 WP_003116471.1.40243 WP_003116471.1.40419 WP_003116471.1.40512 WP_003116471.1.40546 WP_003116471.1.4058 WP_003116471.1.40874 WP_003116471.1.41301 WP_003116471.1.41384 WP_003116471.1.41412 WP_003116471.1.41502 WP_003116471.1.4156 WP_003116471.1.41692 WP_003116471.1.41732 WP_003116471.1.41748 WP_003116471.1.41832 WP_003116471.1.41888 WP_003116471.1.4190 WP_003116471.1.42019 WP_003116471.1.42146 WP_003116471.1.42259 WP_003116471.1.42423 WP_003116471.1.42508 WP_003116471.1.42643 WP_003116471.1.42757 WP_003116471.1.42778 WP_003116471.1.42789 WP_003116471.1.42854 WP_003116471.1.42856 WP_003116471.1.42917 WP_003116471.1.42946 WP_003116471.1.42972 WP_003116471.1.42973 WP_003116471.1.43024 WP_003116471.1.43026 WP_003116471.1.43049 WP_003116471.1.43106 WP_003116471.1.43107 WP_003116471.1.43293 WP_003116471.1.43330 WP_003116471.1.43356 WP_003116471.1.43662 WP_003116471.1.43667 WP_003116471.1.43826 WP_003116471.1.4398 WP_003116471.1.44046 WP_003116471.1.44260 WP_003116471.1.44373 WP_003116471.1.44434 WP_003116471.1.44581 WP_003116471.1.44739 WP_003116471.1.44760 WP_003116471.1.4493 WP_003116471.1.44959 WP_003116471.1.45063 WP_003116471.1.45090 WP_003116471.1.45146 WP_003116471.1.45199 WP_003116471.1.4522 WP_003116471.1.45228 WP_003116471.1.4532 WP_003116471.1.45358 WP_003116471.1.45464 WP_003116471.1.45485 WP_003116471.1.45711 WP_003116471.1.45818 WP_003116471.1.45920 WP_003116471.1.45934 WP_003116471.1.46010 WP_003116471.1.461 WP_003116471.1.46152 WP_003116471.1.46200 WP_003116471.1.46755 WP_003116471.1.46885 WP_003116471.1.46926 WP_003116471.1.4699 WP_003116471.1.47101 WP_003116471.1.47155 WP_003116471.1.47312 WP_003116471.1.47469 WP_003116471.1.47480 WP_003116471.1.47527 WP_003116471.1.47645 WP_003116471.1.47774 WP_003116471.1.47930 WP_003116471.1.48001 WP_003116471.1.48024 WP_003116471.1.48086 WP_003116471.1.48094 WP_003116471.1.48178 WP_003116471.1.48334 WP_003116471.1.4836 WP_003116471.1.48378 WP_003116471.1.48382 WP_003116471.1.48474 WP_003116471.1.48545 WP_003116471.1.48576 WP_003116471.1.48747 WP_003116471.1.48820 WP_003116471.1.48842 WP_003116471.1.49135 WP_003116471.1.49265 WP_003116471.1.49266 WP_003116471.1.49293 WP_003116471.1.49360 WP_003116471.1.49500 WP_003116471.1.49557 WP_003116471.1.49688 WP_003116471.1.49798 WP_003116471.1.49833 WP_003116471.1.49842 WP_003116471.1.49976 WP_003116471.1.49988 WP_003116471.1.49998 WP_003116471.1.50176 WP_003116471.1.50180 WP_003116471.1.50222 WP_003116471.1.5043 WP_003116471.1.50567 WP_003116471.1.50665 WP_003116471.1.50668 WP_003116471.1.50814 WP_003116471.1.50967 WP_003116471.1.50989 WP_003116471.1.51019 WP_003116471.1.51035 WP_003116471.1.51183 WP_003116471.1.51267 WP_003116471.1.51273 WP_003116471.1.5132 WP_003116471.1.51457 WP_003116471.1.51549 WP_003116471.1.51682 WP_003116471.1.51807 WP_003116471.1.51889 WP_003116471.1.52043 WP_003116471.1.52220 WP_003116471.1.52244 WP_003116471.1.5226 WP_003116471.1.52326 WP_003116471.1.52334 WP_003116471.1.52537 WP_003116471.1.5258 WP_003116471.1.52583 WP_003116471.1.5260 WP_003116471.1.52690 WP_003116471.1.52697 WP_003116471.1.52700 WP_003116471.1.52728 WP_003116471.1.52784 WP_003116471.1.53070 WP_003116471.1.53169 WP_003116471.1.53267 WP_003116471.1.53351 WP_003116471.1.53486 WP_003116471.1.53530 WP_003116471.1.53663 WP_003116471.1.53719 WP_003116471.1.53932 WP_003116471.1.54133 WP_003116471.1.5420 WP_003116471.1.54497 WP_003116471.1.54809 WP_003116471.1.54974 WP_003116471.1.55089 WP_003116471.1.55169 WP_003116471.1.55400 WP_003116471.1.55543 WP_003116471.1.55729 WP_003116471.1.56013 WP_003116471.1.56145 WP_003116471.1.56187 WP_003116471.1.56228 WP_003116471.1.56229 WP_003116471.1.56315 WP_003116471.1.56348 WP_003116471.1.56442 WP_003116471.1.56475 WP_003116471.1.56632 WP_003116471.1.56797 WP_003116471.1.56819 WP_003116471.1.56837 WP_003116471.1.56973 WP_003116471.1.57113 WP_003116471.1.57276 WP_003116471.1.57532 WP_003116471.1.57548 WP_003116471.1.57728 WP_003116471.1.58019 WP_003116471.1.58056 WP_003116471.1.58183 WP_003116471.1.58193 WP_003116471.1.58228 WP_003116471.1.58436 WP_003116471.1.58482 WP_003116471.1.58689 WP_003116471.1.58838 WP_003116471.1.58845 WP_003116471.1.5889 WP_003116471.1.59013 WP_003116471.1.59076 WP_003116471.1.59099 WP_003116471.1.59246 WP_003116471.1.59249 WP_003116471.1.59250 WP_003116471.1.59688 WP_003116471.1.59759 WP_003116471.1.59797 WP_003116471.1.60062 WP_003116471.1.60085 WP_003116471.1.60206 WP_003116471.1.60261 WP_003116471.1.60347 WP_003116471.1.60415 WP_003116471.1.60602 WP_003116471.1.60603 WP_003116471.1.60639 WP_003116471.1.60686 WP_003116471.1.60910 WP_003116471.1.60916 WP_003116471.1.61122 WP_003116471.1.61130 WP_003116471.1.61209 WP_003116471.1.6130 WP_003116471.1.61431 WP_003116471.1.61493 WP_003116471.1.61549 WP_003116471.1.61598 WP_003116471.1.61696 WP_003116471.1.6173 WP_003116471.1.62010 WP_003116471.1.62035 WP_003116471.1.62180 WP_003116471.1.62211 WP_003116471.1.62410 WP_003116471.1.62483 WP_003116471.1.62516 WP_003116471.1.62534 WP_003116471.1.62635 WP_003116471.1.62688 WP_003116471.1.62701 WP_003116471.1.62768 WP_003116471.1.6280 WP_003116471.1.62873 WP_003116471.1.63057 WP_003116471.1.63196 WP_003116471.1.63597 WP_003116471.1.63634 WP_003116471.1.63659 WP_003116471.1.63995 WP_003116471.1.64139 WP_003116471.1.64155 WP_003116471.1.64198 WP_003116471.1.64309 WP_003116471.1.64340 WP_003116471.1.64591 WP_003116471.1.64603 WP_003116471.1.64726 WP_003116471.1.64748 WP_003116471.1.64807 WP_003116471.1.64862 WP_003116471.1.64885 WP_003116471.1.64984 WP_003116471.1.65009 WP_003116471.1.65092 WP_003116471.1.65095 WP_003116471.1.65099 WP_003116471.1.65145 WP_003116471.1.65237 WP_003116471.1.65247 WP_003116471.1.65285 WP_003116471.1.65334 WP_003116471.1.65335 WP_003116471.1.65337 WP_003116471.1.65642 WP_003116471.1.65819 WP_003116471.1.65867 WP_003116471.1.6589 WP_003116471.1.65926 WP_003116471.1.66165 WP_003116471.1.66277 WP_003116471.1.6629 WP_003116471.1.66364 WP_003116471.1.66371 WP_003116471.1.66526 WP_003116471.1.66634 WP_003116471.1.66721 WP_003116471.1.66892 WP_003116471.1.66929 WP_003116471.1.66931 WP_003116471.1.66950 WP_003116471.1.67192 WP_003116471.1.67205 WP_003116471.1.67261 WP_003116471.1.67370 WP_003116471.1.67388 WP_003116471.1.67472 WP_003116471.1.67526 WP_003116471.1.67531 WP_003116471.1.67686 WP_003116471.1.67830 WP_003116471.1.67903 WP_003116471.1.67948 WP_003116471.1.68000 WP_003116471.1.68158 WP_003116471.1.68162 WP_003116471.1.68252 WP_003116471.1.68317 WP_003116471.1.6850 WP_003116471.1.68541 WP_003116471.1.68568 WP_003116471.1.68638 WP_003116471.1.68756 WP_003116471.1.68850 WP_003116471.1.68862 WP_003116471.1.68910 WP_003116471.1.68938 WP_003116471.1.69088 WP_003116471.1.69159 WP_003116471.1.69260 WP_003116471.1.69534 WP_003116471.1.69556 WP_003116471.1.69702 WP_003116471.1.69819 WP_003116471.1.69907 WP_003116471.1.69993 WP_003116471.1.70098 WP_003116471.1.70216 WP_003116471.1.70460 WP_003116471.1.70470 WP_003116471.1.70648 WP_003116471.1.70670 WP_003116471.1.70693 WP_003116471.1.7077 WP_003116471.1.70778 WP_003116471.1.71038 WP_003116471.1.7128 WP_003116471.1.71385 WP_003116471.1.71570 WP_003116471.1.71822 WP_003116471.1.72149 WP_003116471.1.72167 WP_003116471.1.72287 WP_003116471.1.72331 WP_003116471.1.72541 WP_003116471.1.72570 WP_003116471.1.7276 WP_003116471.1.72768 WP_003116471.1.72772 WP_003116471.1.73048 WP_003116471.1.7308 WP_003116471.1.73135 WP_003116471.1.73149 WP_003116471.1.73172 WP_003116471.1.7327 WP_003116471.1.73490 WP_003116471.1.73651 WP_003116471.1.73728 WP_003116471.1.73791 WP_003116471.1.7382 WP_003116471.1.73860 WP_003116471.1.73911 WP_003116471.1.74074 WP_003116471.1.7408 WP_003116471.1.74182 WP_003116471.1.74219 WP_003116471.1.7445 WP_003116471.1.74458 WP_003116471.1.74473 WP_003116471.1.7456 WP_003116471.1.74568 WP_003116471.1.74776 WP_003116471.1.748 WP_003116471.1.74958 WP_003116471.1.75119 WP_003116471.1.75277 WP_003116471.1.75303 WP_003116471.1.7547 WP_003116471.1.75549 WP_003116471.1.75573 WP_003116471.1.75771 WP_003116471.1.75825 WP_003116471.1.75826 WP_003116471.1.75935 WP_003116471.1.75938 WP_003116471.1.75947 WP_003116471.1.7595 WP_003116471.1.76092 WP_003116471.1.76192 WP_003116471.1.76322 WP_003116471.1.76383 WP_003116471.1.76399 WP_003116471.1.76484 WP_003116471.1.76600 WP_003116471.1.76633 WP_003116471.1.76716 WP_003116471.1.76985 WP_003116471.1.77235 WP_003116471.1.77238 WP_003116471.1.77286 WP_003116471.1.77317 WP_003116471.1.77490 WP_003116471.1.77566 WP_003116471.1.77574 WP_003116471.1.77587 WP_003116471.1.77769 WP_003116471.1.7779 WP_003116471.1.78134 WP_003116471.1.78280 WP_003116471.1.78409 WP_003116471.1.78430 WP_003116471.1.78437 WP_003116471.1.78570 WP_003116471.1.78693 WP_003116471.1.78795 WP_003116471.1.78810 WP_003116471.1.78947 WP_003116471.1.78954 WP_003116471.1.79007 WP_003116471.1.79053 WP_003116471.1.79256 WP_003116471.1.79279 WP_003116471.1.79311 WP_003116471.1.79364 WP_003116471.1.79429 WP_003116471.1.7945 WP_003116471.1.79507 WP_003116471.1.7953 WP_003116471.1.79569 WP_003116471.1.79601 WP_003116471.1.79631 WP_003116471.1.79788 WP_003116471.1.79908 WP_003116471.1.79986 WP_003116471.1.80033 WP_003116471.1.80087 WP_003116471.1.80174 WP_003116471.1.8028 WP_003116471.1.80410 WP_003116471.1.80481 WP_003116471.1.8051 WP_003116471.1.80632 WP_003116471.1.8064 WP_003116471.1.80846 WP_003116471.1.80880 WP_003116471.1.80892 WP_003116471.1.80931 WP_003116471.1.80938 WP_003116471.1.81081 WP_003116471.1.81082 WP_003116471.1.81487 WP_003116471.1.81581 WP_003116471.1.81643 WP_003116471.1.81728 WP_003116471.1.81816 WP_003116471.1.81834 WP_003116471.1.81844 WP_003116471.1.81950 WP_003116471.1.81957 WP_003116471.1.81960 WP_003116471.1.81986 WP_003116471.1.82127 WP_003116471.1.82260 WP_003116471.1.82310 WP_003116471.1.82312 WP_003116471.1.82328 WP_003116471.1.82334 WP_003116471.1.82604 WP_003116471.1.82606 WP_003116471.1.82620 WP_003116471.1.82643 WP_003116471.1.82710 WP_003116471.1.8284 WP_003116471.1.82882 WP_003116471.1.82936 WP_003116471.1.83131 WP_003116471.1.83184 WP_003116471.1.83251 WP_003116471.1.83296 WP_003116471.1.83394 WP_003116471.1.835 WP_003116471.1.8357 WP_003116471.1.83637 WP_003116471.1.83698 WP_003116471.1.83715 WP_003116471.1.84003 WP_003116471.1.84008 WP_003116471.1.84174 WP_003116471.1.84177 WP_003116471.1.84190 WP_003116471.1.84203 WP_003116471.1.84271 WP_003116471.1.84297 WP_003116471.1.8437 WP_003116471.1.84374 WP_003116471.1.84398 WP_003116471.1.84404 WP_003116471.1.84471 WP_003116471.1.8453 WP_003116471.1.84589 WP_003116471.1.84674 WP_003116471.1.84754 WP_003116471.1.8484 WP_003116471.1.84937 WP_003116471.1.84946 WP_003116471.1.8498 WP_003116471.1.85018 WP_003116471.1.85028 WP_003116471.1.85220 WP_003116471.1.85303 WP_003116471.1.85318 WP_003116471.1.85574 WP_003116471.1.85897 WP_003116471.1.85910 WP_003116471.1.86002 WP_003116471.1.86047 WP_003116471.1.86058 WP_003116471.1.861 WP_003116471.1.86125 WP_003116471.1.86278 WP_003116471.1.86287 WP_003116471.1.86293 WP_003116471.1.865 WP_003116471.1.86545 WP_003116471.1.86552 WP_003116471.1.86652 WP_003116471.1.86708 WP_003116471.1.86785 WP_003116471.1.86813 WP_003116471.1.86985 WP_003116471.1.8718 WP_003116471.1.87182 WP_003116471.1.87316 WP_003116471.1.87435 WP_003116471.1.87530 WP_003116471.1.87547 WP_003116471.1.87970 WP_003116471.1.87981 WP_003116471.1.87987 WP_003116471.1.88004 WP_003116471.1.88308 WP_003116471.1.88517 WP_003116471.1.88578 WP_003116471.1.88680 WP_003116471.1.88714 WP_003116471.1.88900 WP_003116471.1.88949 WP_003116471.1.89098 WP_003116471.1.89245 WP_003116471.1.89266 WP_003116471.1.89434 WP_003116471.1.89440 WP_003116471.1.8949 WP_003116471.1.89491 WP_003116471.1.89577 WP_003116471.1.89610 WP_003116471.1.89638 WP_003116471.1.89662 WP_003116471.1.89736 WP_003116471.1.89776 WP_003116471.1.89805 WP_003116471.1.89866 WP_003116471.1.89867 WP_003116471.1.89886 WP_003116471.1.90024 WP_003116471.1.90032 WP_003116471.1.90141 WP_003116471.1.90150 WP_003116471.1.90189 WP_003116471.1.90224 WP_003116471.1.90225 WP_003116471.1.90242 WP_003116471.1.90306 WP_003116471.1.90412 WP_003116471.1.90569 WP_003116471.1.90655 WP_003116471.1.91093 WP_003116471.1.9120 WP_003116471.1.91204 WP_003116471.1.91360 WP_003116471.1.9143 WP_003116471.1.91431 WP_003116471.1.91438 WP_003116471.1.91585 WP_003116471.1.91803 WP_003116471.1.9182 WP_003116471.1.91846 WP_003116471.1.91860 WP_003116471.1.9191 WP_003116471.1.92454 WP_003116471.1.92573 WP_003116471.1.92585 WP_003116471.1.92624 WP_003116471.1.9272 WP_003116471.1.92769 WP_003116471.1.92847 WP_003116471.1.92924 WP_003116471.1.92930 WP_003116471.1.93090 WP_003116471.1.93144 WP_003116471.1.9328 WP_003116471.1.93446 WP_003116471.1.93498 WP_003116471.1.93797 WP_003116471.1.93848 WP_003116471.1.93897 WP_003116471.1.94004 WP_003116471.1.94031 WP_003116471.1.94174 WP_003116471.1.94218 WP_003116471.1.94243 WP_003116471.1.94285 WP_003116471.1.94385 WP_003116471.1.94434 WP_003116471.1.9444 WP_003116471.1.94450 WP_003116471.1.94682 WP_003116471.1.94814 WP_003116471.1.94818 WP_003116471.1.94874 WP_003116471.1.94896 WP_003116471.1.94897 WP_003116471.1.95025 WP_003116471.1.95027 WP_003116471.1.95117 WP_003116471.1.95187 WP_003116471.1.95207 WP_003116471.1.95305 WP_003116471.1.95460 WP_003116471.1.95525 WP_003116471.1.95536 WP_003116471.1.95668 WP_003116471.1.95745 WP_003116471.1.95751 WP_003116471.1.95787 WP_003116471.1.95802 WP_003116471.1.95820 WP_003116471.1.95825 WP_003116471.1.9599 WP_003116471.1.95994 WP_003116471.1.95999 WP_003116471.1.96008 WP_003116471.1.9604 WP_003116471.1.96134 WP_003116471.1.96193 WP_003116471.1.96243 WP_003116471.1.96267 WP_003116471.1.96357 WP_003116471.1.96506 WP_003116471.1.9706 WP_003116471.1.97118 WP_003116471.1.97126 WP_003116471.1.97213 WP_003116471.1.9722 WP_003116471.1.97271 WP_003116471.1.97474 WP_003116471.1.97614 WP_003116471.1.97968 WP_003116471.1.98260 WP_003116471.1.98308 WP_003116471.1.98410 WP_003116471.1.98414 WP_003116471.1.98522 WP_003116471.1.98610 WP_003116471.1.98672 WP_003116471.1.98678 WP_003116471.1.98693 WP_003116471.1.98814 WP_003116471.1.98958 WP_003116471.1.98960 WP_003116471.1.99103 WP_003116471.1.99214 WP_003116471.1.99353 WP_003116471.1.99461 WP_003116471.1.99654 WP_003116471.1.99757 WP_003116471.1.99795 gi|386057991|ref|YP_005974513.1| 557722.PLES_20251 gi|568153167|ref|YP_008942128.1| gi|218890765|ref|YP_002439629.1| gi|392983238|ref|YP_006481825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]