SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153382|ref|YP_008942343.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153382|ref|YP_008942343.1|
Domain Number 1 Region: 78-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.69e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568153382|ref|YP_008942343.1|
Sequence length 220
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MSLTLYGAPLSPFVRKVRLLLAEKGLDYQLEAIAPFGQPAWYREISPLGRIPALRDGDLA
LADSSVICQYLEERYPEPPNLQGDAPASRAAVRWLEKYADYEIAPLATLTIFRNRILKPA
MGQACEENDVRRALEEKLPAHFDYLENHLDGRAFFVGERLTLADLAIASQLVNLRHAGEN
LDEQRWPALAAHFARMLERPAMQALLPGERRTLDKLAAKA
Download sequence
Identical sequences A0A0C7CZZ8 A0A1C7BV93 A0A1E9CM61 A0A1F0J9H0 A0A1S1C350 Q9I022
NP_251511.1.87394 WP_003114770.1.100071 WP_003114770.1.100100 WP_003114770.1.100420 WP_003114770.1.100473 WP_003114770.1.100654 WP_003114770.1.100786 WP_003114770.1.100808 WP_003114770.1.100810 WP_003114770.1.100872 WP_003114770.1.100983 WP_003114770.1.100995 WP_003114770.1.101340 WP_003114770.1.101572 WP_003114770.1.101739 WP_003114770.1.10179 WP_003114770.1.101819 WP_003114770.1.10185 WP_003114770.1.101863 WP_003114770.1.10202 WP_003114770.1.10204 WP_003114770.1.102045 WP_003114770.1.10228 WP_003114770.1.10457 WP_003114770.1.10468 WP_003114770.1.10477 WP_003114770.1.10529 WP_003114770.1.10572 WP_003114770.1.10636 WP_003114770.1.10641 WP_003114770.1.10901 WP_003114770.1.11026 WP_003114770.1.11077 WP_003114770.1.1109 WP_003114770.1.11163 WP_003114770.1.11381 WP_003114770.1.11568 WP_003114770.1.11653 WP_003114770.1.11744 WP_003114770.1.11754 WP_003114770.1.1180 WP_003114770.1.11847 WP_003114770.1.11854 WP_003114770.1.11943 WP_003114770.1.12018 WP_003114770.1.12240 WP_003114770.1.12482 WP_003114770.1.12497 WP_003114770.1.12530 WP_003114770.1.12561 WP_003114770.1.12687 WP_003114770.1.12873 WP_003114770.1.12891 WP_003114770.1.12922 WP_003114770.1.12970 WP_003114770.1.13 WP_003114770.1.1305 WP_003114770.1.13057 WP_003114770.1.13232 WP_003114770.1.13315 WP_003114770.1.1333 WP_003114770.1.13529 WP_003114770.1.1356 WP_003114770.1.1362 WP_003114770.1.13622 WP_003114770.1.13765 WP_003114770.1.13785 WP_003114770.1.13828 WP_003114770.1.1393 WP_003114770.1.14078 WP_003114770.1.14096 WP_003114770.1.14378 WP_003114770.1.14424 WP_003114770.1.14460 WP_003114770.1.14714 WP_003114770.1.1475 WP_003114770.1.14797 WP_003114770.1.14820 WP_003114770.1.14835 WP_003114770.1.14839 WP_003114770.1.15231 WP_003114770.1.15281 WP_003114770.1.15373 WP_003114770.1.15474 WP_003114770.1.15480 WP_003114770.1.15485 WP_003114770.1.15602 WP_003114770.1.15606 WP_003114770.1.15886 WP_003114770.1.15934 WP_003114770.1.16109 WP_003114770.1.16142 WP_003114770.1.16239 WP_003114770.1.16242 WP_003114770.1.16267 WP_003114770.1.1646 WP_003114770.1.1671 WP_003114770.1.16782 WP_003114770.1.16788 WP_003114770.1.16801 WP_003114770.1.16895 WP_003114770.1.17022 WP_003114770.1.17155 WP_003114770.1.172 WP_003114770.1.17370 WP_003114770.1.1739 WP_003114770.1.17566 WP_003114770.1.17697 WP_003114770.1.17883 WP_003114770.1.17890 WP_003114770.1.18052 WP_003114770.1.18199 WP_003114770.1.18204 WP_003114770.1.18234 WP_003114770.1.1824 WP_003114770.1.18493 WP_003114770.1.18653 WP_003114770.1.18728 WP_003114770.1.18735 WP_003114770.1.18769 WP_003114770.1.190 WP_003114770.1.19269 WP_003114770.1.19376 WP_003114770.1.19552 WP_003114770.1.19591 WP_003114770.1.19711 WP_003114770.1.19741 WP_003114770.1.19771 WP_003114770.1.20070 WP_003114770.1.20125 WP_003114770.1.20154 WP_003114770.1.20342 WP_003114770.1.20682 WP_003114770.1.20744 WP_003114770.1.20764 WP_003114770.1.20884 WP_003114770.1.209 WP_003114770.1.21242 WP_003114770.1.21349 WP_003114770.1.21358 WP_003114770.1.21448 WP_003114770.1.21469 WP_003114770.1.21517 WP_003114770.1.21607 WP_003114770.1.21718 WP_003114770.1.2172 WP_003114770.1.21744 WP_003114770.1.21767 WP_003114770.1.21801 WP_003114770.1.21863 WP_003114770.1.21871 WP_003114770.1.21891 WP_003114770.1.21932 WP_003114770.1.221 WP_003114770.1.22316 WP_003114770.1.22324 WP_003114770.1.22389 WP_003114770.1.22394 WP_003114770.1.22442 WP_003114770.1.22477 WP_003114770.1.22491 WP_003114770.1.22573 WP_003114770.1.22704 WP_003114770.1.22863 WP_003114770.1.2289 WP_003114770.1.22891 WP_003114770.1.23013 WP_003114770.1.23191 WP_003114770.1.23195 WP_003114770.1.23264 WP_003114770.1.23394 WP_003114770.1.23421 WP_003114770.1.23512 WP_003114770.1.23525 WP_003114770.1.23581 WP_003114770.1.23641 WP_003114770.1.23715 WP_003114770.1.23769 WP_003114770.1.23782 WP_003114770.1.23961 WP_003114770.1.23983 WP_003114770.1.24066 WP_003114770.1.24077 WP_003114770.1.24087 WP_003114770.1.24351 WP_003114770.1.24447 WP_003114770.1.2453 WP_003114770.1.24626 WP_003114770.1.24851 WP_003114770.1.24862 WP_003114770.1.24879 WP_003114770.1.24938 WP_003114770.1.25052 WP_003114770.1.25067 WP_003114770.1.251 WP_003114770.1.25109 WP_003114770.1.25142 WP_003114770.1.25149 WP_003114770.1.25348 WP_003114770.1.2535 WP_003114770.1.25532 WP_003114770.1.25675 WP_003114770.1.25695 WP_003114770.1.2572 WP_003114770.1.2596 WP_003114770.1.25964 WP_003114770.1.261 WP_003114770.1.26334 WP_003114770.1.26428 WP_003114770.1.26489 WP_003114770.1.26539 WP_003114770.1.26592 WP_003114770.1.26604 WP_003114770.1.26681 WP_003114770.1.26682 WP_003114770.1.26705 WP_003114770.1.26816 WP_003114770.1.26841 WP_003114770.1.27018 WP_003114770.1.27039 WP_003114770.1.27211 WP_003114770.1.27259 WP_003114770.1.27505 WP_003114770.1.27534 WP_003114770.1.27575 WP_003114770.1.27587 WP_003114770.1.27687 WP_003114770.1.27738 WP_003114770.1.27772 WP_003114770.1.27825 WP_003114770.1.27837 WP_003114770.1.27858 WP_003114770.1.27966 WP_003114770.1.28006 WP_003114770.1.28064 WP_003114770.1.28258 WP_003114770.1.28316 WP_003114770.1.28329 WP_003114770.1.28372 WP_003114770.1.28382 WP_003114770.1.28383 WP_003114770.1.28468 WP_003114770.1.28505 WP_003114770.1.28623 WP_003114770.1.28823 WP_003114770.1.28849 WP_003114770.1.28920 WP_003114770.1.29062 WP_003114770.1.29096 WP_003114770.1.29137 WP_003114770.1.29179 WP_003114770.1.29208 WP_003114770.1.29401 WP_003114770.1.2941 WP_003114770.1.29438 WP_003114770.1.2948 WP_003114770.1.29481 WP_003114770.1.2980 WP_003114770.1.29848 WP_003114770.1.29920 WP_003114770.1.30081 WP_003114770.1.30567 WP_003114770.1.30614 WP_003114770.1.30707 WP_003114770.1.30886 WP_003114770.1.31076 WP_003114770.1.31087 WP_003114770.1.31105 WP_003114770.1.31138 WP_003114770.1.31147 WP_003114770.1.31279 WP_003114770.1.31587 WP_003114770.1.31852 WP_003114770.1.32134 WP_003114770.1.32144 WP_003114770.1.32289 WP_003114770.1.32314 WP_003114770.1.32447 WP_003114770.1.32544 WP_003114770.1.32637 WP_003114770.1.32869 WP_003114770.1.33133 WP_003114770.1.33152 WP_003114770.1.33186 WP_003114770.1.33204 WP_003114770.1.33210 WP_003114770.1.33216 WP_003114770.1.33340 WP_003114770.1.3351 WP_003114770.1.33521 WP_003114770.1.33549 WP_003114770.1.33653 WP_003114770.1.33658 WP_003114770.1.33733 WP_003114770.1.3376 WP_003114770.1.33822 WP_003114770.1.34000 WP_003114770.1.34143 WP_003114770.1.34151 WP_003114770.1.34306 WP_003114770.1.34317 WP_003114770.1.34401 WP_003114770.1.34402 WP_003114770.1.34670 WP_003114770.1.34832 WP_003114770.1.34878 WP_003114770.1.34901 WP_003114770.1.35104 WP_003114770.1.35149 WP_003114770.1.3531 WP_003114770.1.35431 WP_003114770.1.35480 WP_003114770.1.35573 WP_003114770.1.35679 WP_003114770.1.35682 WP_003114770.1.3576 WP_003114770.1.35762 WP_003114770.1.35768 WP_003114770.1.35822 WP_003114770.1.35843 WP_003114770.1.35857 WP_003114770.1.35872 WP_003114770.1.35984 WP_003114770.1.36170 WP_003114770.1.3653 WP_003114770.1.36587 WP_003114770.1.36630 WP_003114770.1.36665 WP_003114770.1.3672 WP_003114770.1.37163 WP_003114770.1.37172 WP_003114770.1.3721 WP_003114770.1.37216 WP_003114770.1.37319 WP_003114770.1.37366 WP_003114770.1.3781 WP_003114770.1.37814 WP_003114770.1.37842 WP_003114770.1.3785 WP_003114770.1.38102 WP_003114770.1.38146 WP_003114770.1.38151 WP_003114770.1.38186 WP_003114770.1.3833 WP_003114770.1.38502 WP_003114770.1.38583 WP_003114770.1.38657 WP_003114770.1.38661 WP_003114770.1.3887 WP_003114770.1.38889 WP_003114770.1.38971 WP_003114770.1.39088 WP_003114770.1.39122 WP_003114770.1.39186 WP_003114770.1.39271 WP_003114770.1.39326 WP_003114770.1.3943 WP_003114770.1.39444 WP_003114770.1.39537 WP_003114770.1.39704 WP_003114770.1.39786 WP_003114770.1.39811 WP_003114770.1.40059 WP_003114770.1.40213 WP_003114770.1.40243 WP_003114770.1.40512 WP_003114770.1.40546 WP_003114770.1.40874 WP_003114770.1.40950 WP_003114770.1.40994 WP_003114770.1.41301 WP_003114770.1.41384 WP_003114770.1.41412 WP_003114770.1.41692 WP_003114770.1.41725 WP_003114770.1.41732 WP_003114770.1.41748 WP_003114770.1.41773 WP_003114770.1.41832 WP_003114770.1.41871 WP_003114770.1.41888 WP_003114770.1.4190 WP_003114770.1.42019 WP_003114770.1.42146 WP_003114770.1.42508 WP_003114770.1.42757 WP_003114770.1.42854 WP_003114770.1.42856 WP_003114770.1.42917 WP_003114770.1.42946 WP_003114770.1.42952 WP_003114770.1.42972 WP_003114770.1.42973 WP_003114770.1.43024 WP_003114770.1.43026 WP_003114770.1.43049 WP_003114770.1.43107 WP_003114770.1.43293 WP_003114770.1.43315 WP_003114770.1.43330 WP_003114770.1.43356 WP_003114770.1.4348 WP_003114770.1.43603 WP_003114770.1.43662 WP_003114770.1.43667 WP_003114770.1.43729 WP_003114770.1.43802 WP_003114770.1.43826 WP_003114770.1.44094 WP_003114770.1.44213 WP_003114770.1.44260 WP_003114770.1.44434 WP_003114770.1.44565 WP_003114770.1.44581 WP_003114770.1.44739 WP_003114770.1.44959 WP_003114770.1.45063 WP_003114770.1.45090 WP_003114770.1.45146 WP_003114770.1.45202 WP_003114770.1.45228 WP_003114770.1.4532 WP_003114770.1.45328 WP_003114770.1.45358 WP_003114770.1.45464 WP_003114770.1.45478 WP_003114770.1.45485 WP_003114770.1.45711 WP_003114770.1.45934 WP_003114770.1.46010 WP_003114770.1.46032 WP_003114770.1.461 WP_003114770.1.46152 WP_003114770.1.46200 WP_003114770.1.46436 WP_003114770.1.46502 WP_003114770.1.46755 WP_003114770.1.46885 WP_003114770.1.46926 WP_003114770.1.4699 WP_003114770.1.47101 WP_003114770.1.47155 WP_003114770.1.47296 WP_003114770.1.47312 WP_003114770.1.47469 WP_003114770.1.47480 WP_003114770.1.47527 WP_003114770.1.47645 WP_003114770.1.47774 WP_003114770.1.47930 WP_003114770.1.47970 WP_003114770.1.48001 WP_003114770.1.48086 WP_003114770.1.48172 WP_003114770.1.48334 WP_003114770.1.4836 WP_003114770.1.48378 WP_003114770.1.48382 WP_003114770.1.48413 WP_003114770.1.48474 WP_003114770.1.48545 WP_003114770.1.48576 WP_003114770.1.48820 WP_003114770.1.48842 WP_003114770.1.48961 WP_003114770.1.4913 WP_003114770.1.49184 WP_003114770.1.49265 WP_003114770.1.49266 WP_003114770.1.49286 WP_003114770.1.49293 WP_003114770.1.49360 WP_003114770.1.49416 WP_003114770.1.49688 WP_003114770.1.49798 WP_003114770.1.49842 WP_003114770.1.49988 WP_003114770.1.49998 WP_003114770.1.50176 WP_003114770.1.50180 WP_003114770.1.5043 WP_003114770.1.50567 WP_003114770.1.50653 WP_003114770.1.50734 WP_003114770.1.50814 WP_003114770.1.50989 WP_003114770.1.51019 WP_003114770.1.51035 WP_003114770.1.51136 WP_003114770.1.51183 WP_003114770.1.51267 WP_003114770.1.51273 WP_003114770.1.51538 WP_003114770.1.51549 WP_003114770.1.51682 WP_003114770.1.51733 WP_003114770.1.51807 WP_003114770.1.51847 WP_003114770.1.51889 WP_003114770.1.51917 WP_003114770.1.51937 WP_003114770.1.51976 WP_003114770.1.52043 WP_003114770.1.52220 WP_003114770.1.52244 WP_003114770.1.5226 WP_003114770.1.52537 WP_003114770.1.5258 WP_003114770.1.52583 WP_003114770.1.5260 WP_003114770.1.52690 WP_003114770.1.52700 WP_003114770.1.52784 WP_003114770.1.5294 WP_003114770.1.53072 WP_003114770.1.53169 WP_003114770.1.53267 WP_003114770.1.53371 WP_003114770.1.53486 WP_003114770.1.53663 WP_003114770.1.53719 WP_003114770.1.53726 WP_003114770.1.5388 WP_003114770.1.53932 WP_003114770.1.53948 WP_003114770.1.5399 WP_003114770.1.54090 WP_003114770.1.54133 WP_003114770.1.5427 WP_003114770.1.54497 WP_003114770.1.54809 WP_003114770.1.55089 WP_003114770.1.55169 WP_003114770.1.55347 WP_003114770.1.55400 WP_003114770.1.55729 WP_003114770.1.55976 WP_003114770.1.56013 WP_003114770.1.56145 WP_003114770.1.56187 WP_003114770.1.56228 WP_003114770.1.56315 WP_003114770.1.56442 WP_003114770.1.56632 WP_003114770.1.56745 WP_003114770.1.56797 WP_003114770.1.56819 WP_003114770.1.56973 WP_003114770.1.57276 WP_003114770.1.57477 WP_003114770.1.57548 WP_003114770.1.57566 WP_003114770.1.58019 WP_003114770.1.58056 WP_003114770.1.58183 WP_003114770.1.58193 WP_003114770.1.58228 WP_003114770.1.58482 WP_003114770.1.58527 WP_003114770.1.58689 WP_003114770.1.58838 WP_003114770.1.58845 WP_003114770.1.59076 WP_003114770.1.59156 WP_003114770.1.59176 WP_003114770.1.59249 WP_003114770.1.59288 WP_003114770.1.59688 WP_003114770.1.59797 WP_003114770.1.59831 WP_003114770.1.60051 WP_003114770.1.60062 WP_003114770.1.60415 WP_003114770.1.60467 WP_003114770.1.60509 WP_003114770.1.60600 WP_003114770.1.60602 WP_003114770.1.60603 WP_003114770.1.60639 WP_003114770.1.60686 WP_003114770.1.60850 WP_003114770.1.60916 WP_003114770.1.61122 WP_003114770.1.61130 WP_003114770.1.61209 WP_003114770.1.6130 WP_003114770.1.61431 WP_003114770.1.61549 WP_003114770.1.61598 WP_003114770.1.61696 WP_003114770.1.62010 WP_003114770.1.62180 WP_003114770.1.62357 WP_003114770.1.62410 WP_003114770.1.62483 WP_003114770.1.62516 WP_003114770.1.62534 WP_003114770.1.62701 WP_003114770.1.62716 WP_003114770.1.62768 WP_003114770.1.62772 WP_003114770.1.6280 WP_003114770.1.62834 WP_003114770.1.62873 WP_003114770.1.63041 WP_003114770.1.63057 WP_003114770.1.63193 WP_003114770.1.63196 WP_003114770.1.63338 WP_003114770.1.63597 WP_003114770.1.63659 WP_003114770.1.63995 WP_003114770.1.64198 WP_003114770.1.64309 WP_003114770.1.64329 WP_003114770.1.64340 WP_003114770.1.64433 WP_003114770.1.64591 WP_003114770.1.64603 WP_003114770.1.64807 WP_003114770.1.64854 WP_003114770.1.64862 WP_003114770.1.64983 WP_003114770.1.64984 WP_003114770.1.65009 WP_003114770.1.65066 WP_003114770.1.65092 WP_003114770.1.65095 WP_003114770.1.65099 WP_003114770.1.65145 WP_003114770.1.65247 WP_003114770.1.65316 WP_003114770.1.65335 WP_003114770.1.65337 WP_003114770.1.65549 WP_003114770.1.65642 WP_003114770.1.65740 WP_003114770.1.65819 WP_003114770.1.65867 WP_003114770.1.65926 WP_003114770.1.66165 WP_003114770.1.66277 WP_003114770.1.6629 WP_003114770.1.66348 WP_003114770.1.66371 WP_003114770.1.66526 WP_003114770.1.66634 WP_003114770.1.66929 WP_003114770.1.66950 WP_003114770.1.67188 WP_003114770.1.67192 WP_003114770.1.67205 WP_003114770.1.67261 WP_003114770.1.67370 WP_003114770.1.67388 WP_003114770.1.67472 WP_003114770.1.67526 WP_003114770.1.67531 WP_003114770.1.67686 WP_003114770.1.67755 WP_003114770.1.67830 WP_003114770.1.67903 WP_003114770.1.68000 WP_003114770.1.68252 WP_003114770.1.68317 WP_003114770.1.68472 WP_003114770.1.6850 WP_003114770.1.68541 WP_003114770.1.68568 WP_003114770.1.68638 WP_003114770.1.68756 WP_003114770.1.68781 WP_003114770.1.68800 WP_003114770.1.68802 WP_003114770.1.68850 WP_003114770.1.68857 WP_003114770.1.68862 WP_003114770.1.68910 WP_003114770.1.68938 WP_003114770.1.69088 WP_003114770.1.69159 WP_003114770.1.69260 WP_003114770.1.6928 WP_003114770.1.69702 WP_003114770.1.69788 WP_003114770.1.69907 WP_003114770.1.69993 WP_003114770.1.70092 WP_003114770.1.70098 WP_003114770.1.70168 WP_003114770.1.70194 WP_003114770.1.70216 WP_003114770.1.70229 WP_003114770.1.70561 WP_003114770.1.70583 WP_003114770.1.70648 WP_003114770.1.70677 WP_003114770.1.7077 WP_003114770.1.70778 WP_003114770.1.71038 WP_003114770.1.7128 WP_003114770.1.71346 WP_003114770.1.71385 WP_003114770.1.71806 WP_003114770.1.71822 WP_003114770.1.71934 WP_003114770.1.72149 WP_003114770.1.72167 WP_003114770.1.72181 WP_003114770.1.72287 WP_003114770.1.72331 WP_003114770.1.72541 WP_003114770.1.72653 WP_003114770.1.7276 WP_003114770.1.72768 WP_003114770.1.73048 WP_003114770.1.7308 WP_003114770.1.73149 WP_003114770.1.73172 WP_003114770.1.7327 WP_003114770.1.733 WP_003114770.1.73455 WP_003114770.1.73490 WP_003114770.1.73523 WP_003114770.1.73541 WP_003114770.1.73728 WP_003114770.1.73791 WP_003114770.1.7382 WP_003114770.1.73860 WP_003114770.1.73911 WP_003114770.1.74074 WP_003114770.1.7408 WP_003114770.1.74106 WP_003114770.1.74182 WP_003114770.1.74219 WP_003114770.1.74268 WP_003114770.1.74458 WP_003114770.1.74473 WP_003114770.1.74475 WP_003114770.1.74518 WP_003114770.1.7456 WP_003114770.1.74568 WP_003114770.1.748 WP_003114770.1.74948 WP_003114770.1.74958 WP_003114770.1.75041 WP_003114770.1.75119 WP_003114770.1.75204 WP_003114770.1.75277 WP_003114770.1.75303 WP_003114770.1.7547 WP_003114770.1.75549 WP_003114770.1.75573 WP_003114770.1.75599 WP_003114770.1.75792 WP_003114770.1.75825 WP_003114770.1.75935 WP_003114770.1.75938 WP_003114770.1.7595 WP_003114770.1.76322 WP_003114770.1.76355 WP_003114770.1.76383 WP_003114770.1.76399 WP_003114770.1.76484 WP_003114770.1.76600 WP_003114770.1.76633 WP_003114770.1.76716 WP_003114770.1.77235 WP_003114770.1.77238 WP_003114770.1.77286 WP_003114770.1.77317 WP_003114770.1.77476 WP_003114770.1.77490 WP_003114770.1.77566 WP_003114770.1.77574 WP_003114770.1.77587 WP_003114770.1.77769 WP_003114770.1.77819 WP_003114770.1.77834 WP_003114770.1.78134 WP_003114770.1.78280 WP_003114770.1.78380 WP_003114770.1.78409 WP_003114770.1.78430 WP_003114770.1.78570 WP_003114770.1.78693 WP_003114770.1.78795 WP_003114770.1.78947 WP_003114770.1.78954 WP_003114770.1.78986 WP_003114770.1.79007 WP_003114770.1.79256 WP_003114770.1.79279 WP_003114770.1.79311 WP_003114770.1.79364 WP_003114770.1.7945 WP_003114770.1.79463 WP_003114770.1.79507 WP_003114770.1.7953 WP_003114770.1.79544 WP_003114770.1.79569 WP_003114770.1.79601 WP_003114770.1.79699 WP_003114770.1.79788 WP_003114770.1.79908 WP_003114770.1.79986 WP_003114770.1.80033 WP_003114770.1.80068 WP_003114770.1.80087 WP_003114770.1.8028 WP_003114770.1.80306 WP_003114770.1.80410 WP_003114770.1.80411 WP_003114770.1.80572 WP_003114770.1.80627 WP_003114770.1.80632 WP_003114770.1.8064 WP_003114770.1.80645 WP_003114770.1.80720 WP_003114770.1.80880 WP_003114770.1.80892 WP_003114770.1.80931 WP_003114770.1.81081 WP_003114770.1.81082 WP_003114770.1.8110 WP_003114770.1.81237 WP_003114770.1.81482 WP_003114770.1.81728 WP_003114770.1.81742 WP_003114770.1.81771 WP_003114770.1.81816 WP_003114770.1.81834 WP_003114770.1.81844 WP_003114770.1.81950 WP_003114770.1.81957 WP_003114770.1.81960 WP_003114770.1.82310 WP_003114770.1.82312 WP_003114770.1.82328 WP_003114770.1.82334 WP_003114770.1.82604 WP_003114770.1.82620 WP_003114770.1.82710 WP_003114770.1.82882 WP_003114770.1.82936 WP_003114770.1.83131 WP_003114770.1.83184 WP_003114770.1.83251 WP_003114770.1.83296 WP_003114770.1.83394 WP_003114770.1.835 WP_003114770.1.8357 WP_003114770.1.83673 WP_003114770.1.83698 WP_003114770.1.83715 WP_003114770.1.83946 WP_003114770.1.84003 WP_003114770.1.84008 WP_003114770.1.84174 WP_003114770.1.84190 WP_003114770.1.84271 WP_003114770.1.84297 WP_003114770.1.8437 WP_003114770.1.84374 WP_003114770.1.84398 WP_003114770.1.84404 WP_003114770.1.84471 WP_003114770.1.8453 WP_003114770.1.84674 WP_003114770.1.84702 WP_003114770.1.84715 WP_003114770.1.8484 WP_003114770.1.84937 WP_003114770.1.85028 WP_003114770.1.85220 WP_003114770.1.85290 WP_003114770.1.85318 WP_003114770.1.85788 WP_003114770.1.85897 WP_003114770.1.85910 WP_003114770.1.86002 WP_003114770.1.86047 WP_003114770.1.86058 WP_003114770.1.861 WP_003114770.1.86125 WP_003114770.1.86278 WP_003114770.1.865 WP_003114770.1.86545 WP_003114770.1.86552 WP_003114770.1.86652 WP_003114770.1.86785 WP_003114770.1.86813 WP_003114770.1.8693 WP_003114770.1.86985 WP_003114770.1.87163 WP_003114770.1.8718 WP_003114770.1.87316 WP_003114770.1.87390 WP_003114770.1.87435 WP_003114770.1.87530 WP_003114770.1.87547 WP_003114770.1.87648 WP_003114770.1.87970 WP_003114770.1.87981 WP_003114770.1.87987 WP_003114770.1.88004 WP_003114770.1.88388 WP_003114770.1.88578 WP_003114770.1.88659 WP_003114770.1.88680 WP_003114770.1.88714 WP_003114770.1.89098 WP_003114770.1.8911 WP_003114770.1.89245 WP_003114770.1.89276 WP_003114770.1.89409 WP_003114770.1.89434 WP_003114770.1.89491 WP_003114770.1.89577 WP_003114770.1.89610 WP_003114770.1.89638 WP_003114770.1.89662 WP_003114770.1.89736 WP_003114770.1.8976 WP_003114770.1.89776 WP_003114770.1.89805 WP_003114770.1.89866 WP_003114770.1.89867 WP_003114770.1.89886 WP_003114770.1.90032 WP_003114770.1.90056 WP_003114770.1.90141 WP_003114770.1.90150 WP_003114770.1.90189 WP_003114770.1.90224 WP_003114770.1.90225 WP_003114770.1.90242 WP_003114770.1.90306 WP_003114770.1.90412 WP_003114770.1.9056 WP_003114770.1.90569 WP_003114770.1.90655 WP_003114770.1.91093 WP_003114770.1.91161 WP_003114770.1.9120 WP_003114770.1.91204 WP_003114770.1.91307 WP_003114770.1.9143 WP_003114770.1.91431 WP_003114770.1.91438 WP_003114770.1.91862 WP_003114770.1.9191 WP_003114770.1.91943 WP_003114770.1.92043 WP_003114770.1.92175 WP_003114770.1.92314 WP_003114770.1.92321 WP_003114770.1.92357 WP_003114770.1.92573 WP_003114770.1.9272 WP_003114770.1.92769 WP_003114770.1.92847 WP_003114770.1.92924 WP_003114770.1.92930 WP_003114770.1.93090 WP_003114770.1.93130 WP_003114770.1.93144 WP_003114770.1.93250 WP_003114770.1.93264 WP_003114770.1.9328 WP_003114770.1.93498 WP_003114770.1.93797 WP_003114770.1.94004 WP_003114770.1.94031 WP_003114770.1.94174 WP_003114770.1.94218 WP_003114770.1.94243 WP_003114770.1.94385 WP_003114770.1.94434 WP_003114770.1.9444 WP_003114770.1.94682 WP_003114770.1.94814 WP_003114770.1.94874 WP_003114770.1.94897 WP_003114770.1.95025 WP_003114770.1.95027 WP_003114770.1.95117 WP_003114770.1.95187 WP_003114770.1.95217 WP_003114770.1.95460 WP_003114770.1.95525 WP_003114770.1.95745 WP_003114770.1.95751 WP_003114770.1.95787 WP_003114770.1.95802 WP_003114770.1.95820 WP_003114770.1.95825 WP_003114770.1.9599 WP_003114770.1.96134 WP_003114770.1.96193 WP_003114770.1.96243 WP_003114770.1.96267 WP_003114770.1.96506 WP_003114770.1.96702 WP_003114770.1.96967 WP_003114770.1.9706 WP_003114770.1.97118 WP_003114770.1.97213 WP_003114770.1.9722 WP_003114770.1.97271 WP_003114770.1.97272 WP_003114770.1.97474 WP_003114770.1.97614 WP_003114770.1.97968 WP_003114770.1.98410 WP_003114770.1.98414 WP_003114770.1.98433 WP_003114770.1.98522 WP_003114770.1.98573 WP_003114770.1.98600 WP_003114770.1.98610 WP_003114770.1.98672 WP_003114770.1.98678 WP_003114770.1.98718 WP_003114770.1.98788 WP_003114770.1.98814 WP_003114770.1.9885 WP_003114770.1.98907 WP_003114770.1.98958 WP_003114770.1.98960 WP_003114770.1.99293 WP_003114770.1.99654 WP_003114770.1.99662 WP_003114770.1.99746 WP_003114770.1.99757 WP_003114770.1.99795 gi|218890981|ref|YP_002439847.1| gi|386058206|ref|YP_005974728.1| gi|568153382|ref|YP_008942343.1| gi|514410097|ref|YP_008133450.1| gi|392983456|ref|YP_006482043.1| gi|15598017|ref|NP_251511.1| 208964.PA2821 557722.PLES_22441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]