SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153398|ref|YP_008942359.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153398|ref|YP_008942359.1|
Domain Number 1 Region: 80-201
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.49e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568153398|ref|YP_008942359.1|
Sequence length 206
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MLTIWGRKNSSNVRKALWCAEEAGLEYRTVDAGGAFGLVDEPAFRAMNPNGRVPVIEDDG
FVLWESNAIVRYLAARYAPGDLYPQDPVRRADADKWMDWTTSTLAGPFRDLFWGTLRTPP
EQRDEALIAKALQTCGELLRVPDQTLAGQPWLSGERFGMGDIPLGCFIYAWFEMPIERPP
LPHLEAWYLRLRERPAFRTAVMTELT
Download sequence
Identical sequences A0A0C6F8C4 A0A0H3RAN8 A0A157W7D7 A0A1E9CLC1 Q9I030 W1MK71
gi|15598009|ref|NP_251503.1| gi|568153398|ref|YP_008942359.1| NP_251503.1.87394 WP_003108953.1.100071 WP_003108953.1.100179 WP_003108953.1.100276 WP_003108953.1.100278 WP_003108953.1.100394 WP_003108953.1.100420 WP_003108953.1.100473 WP_003108953.1.100476 WP_003108953.1.100723 WP_003108953.1.100742 WP_003108953.1.100777 WP_003108953.1.100808 WP_003108953.1.100809 WP_003108953.1.100810 WP_003108953.1.100983 WP_003108953.1.100995 WP_003108953.1.101021 WP_003108953.1.101090 WP_003108953.1.101269 WP_003108953.1.101340 WP_003108953.1.101506 WP_003108953.1.101642 WP_003108953.1.101712 WP_003108953.1.101739 WP_003108953.1.101819 WP_003108953.1.10185 WP_003108953.1.10201 WP_003108953.1.102045 WP_003108953.1.10248 WP_003108953.1.10257 WP_003108953.1.1037 WP_003108953.1.10407 WP_003108953.1.10419 WP_003108953.1.10457 WP_003108953.1.10482 WP_003108953.1.10572 WP_003108953.1.10575 WP_003108953.1.10636 WP_003108953.1.10641 WP_003108953.1.10684 WP_003108953.1.10764 WP_003108953.1.10856 WP_003108953.1.10895 WP_003108953.1.10949 WP_003108953.1.11026 WP_003108953.1.11058 WP_003108953.1.11077 WP_003108953.1.1109 WP_003108953.1.11163 WP_003108953.1.11178 WP_003108953.1.11318 WP_003108953.1.11388 WP_003108953.1.11410 WP_003108953.1.11454 WP_003108953.1.11569 WP_003108953.1.11653 WP_003108953.1.11744 WP_003108953.1.1180 WP_003108953.1.11847 WP_003108953.1.1187 WP_003108953.1.11943 WP_003108953.1.12018 WP_003108953.1.12120 WP_003108953.1.12150 WP_003108953.1.12200 WP_003108953.1.12208 WP_003108953.1.12240 WP_003108953.1.1238 WP_003108953.1.12400 WP_003108953.1.12482 WP_003108953.1.12497 WP_003108953.1.12530 WP_003108953.1.12547 WP_003108953.1.12561 WP_003108953.1.12657 WP_003108953.1.12670 WP_003108953.1.12797 WP_003108953.1.12873 WP_003108953.1.12891 WP_003108953.1.12930 WP_003108953.1.12970 WP_003108953.1.12980 WP_003108953.1.13 WP_003108953.1.13041 WP_003108953.1.1305 WP_003108953.1.13057 WP_003108953.1.13085 WP_003108953.1.13092 WP_003108953.1.13208 WP_003108953.1.13232 WP_003108953.1.13242 WP_003108953.1.13266 WP_003108953.1.13270 WP_003108953.1.13315 WP_003108953.1.1333 WP_003108953.1.13407 WP_003108953.1.13533 WP_003108953.1.1356 WP_003108953.1.1362 WP_003108953.1.13622 WP_003108953.1.13718 WP_003108953.1.13743 WP_003108953.1.13758 WP_003108953.1.13765 WP_003108953.1.13828 WP_003108953.1.13865 WP_003108953.1.1393 WP_003108953.1.14049 WP_003108953.1.14096 WP_003108953.1.14204 WP_003108953.1.14251 WP_003108953.1.14378 WP_003108953.1.14463 WP_003108953.1.14525 WP_003108953.1.14714 WP_003108953.1.1475 WP_003108953.1.14754 WP_003108953.1.14815 WP_003108953.1.14820 WP_003108953.1.14839 WP_003108953.1.14966 WP_003108953.1.14981 WP_003108953.1.1516 WP_003108953.1.152 WP_003108953.1.15231 WP_003108953.1.15281 WP_003108953.1.15297 WP_003108953.1.15373 WP_003108953.1.15379 WP_003108953.1.15474 WP_003108953.1.15480 WP_003108953.1.15482 WP_003108953.1.15485 WP_003108953.1.15602 WP_003108953.1.15692 WP_003108953.1.15886 WP_003108953.1.15889 WP_003108953.1.16041 WP_003108953.1.16074 WP_003108953.1.16109 WP_003108953.1.16142 WP_003108953.1.16161 WP_003108953.1.16197 WP_003108953.1.1646 WP_003108953.1.16660 WP_003108953.1.1670 WP_003108953.1.1671 WP_003108953.1.16751 WP_003108953.1.16808 WP_003108953.1.16811 WP_003108953.1.16895 WP_003108953.1.1704 WP_003108953.1.17108 WP_003108953.1.17155 WP_003108953.1.17162 WP_003108953.1.17177 WP_003108953.1.17223 WP_003108953.1.1739 WP_003108953.1.17397 WP_003108953.1.17566 WP_003108953.1.1758 WP_003108953.1.17697 WP_003108953.1.17883 WP_003108953.1.17890 WP_003108953.1.18054 WP_003108953.1.18156 WP_003108953.1.18157 WP_003108953.1.18199 WP_003108953.1.1824 WP_003108953.1.18440 WP_003108953.1.18508 WP_003108953.1.18547 WP_003108953.1.18653 WP_003108953.1.18735 WP_003108953.1.18795 WP_003108953.1.18892 WP_003108953.1.18907 WP_003108953.1.18911 WP_003108953.1.18930 WP_003108953.1.190 WP_003108953.1.19089 WP_003108953.1.19199 WP_003108953.1.19251 WP_003108953.1.19260 WP_003108953.1.19269 WP_003108953.1.19351 WP_003108953.1.19376 WP_003108953.1.1938 WP_003108953.1.19591 WP_003108953.1.19640 WP_003108953.1.19703 WP_003108953.1.1971 WP_003108953.1.19718 WP_003108953.1.19741 WP_003108953.1.19771 WP_003108953.1.19824 WP_003108953.1.19931 WP_003108953.1.20024 WP_003108953.1.2012 WP_003108953.1.20125 WP_003108953.1.20134 WP_003108953.1.20216 WP_003108953.1.20342 WP_003108953.1.20682 WP_003108953.1.20692 WP_003108953.1.20744 WP_003108953.1.20764 WP_003108953.1.20825 WP_003108953.1.20854 WP_003108953.1.20880 WP_003108953.1.20884 WP_003108953.1.20890 WP_003108953.1.209 WP_003108953.1.21096 WP_003108953.1.21100 WP_003108953.1.21166 WP_003108953.1.21242 WP_003108953.1.21349 WP_003108953.1.2144 WP_003108953.1.21448 WP_003108953.1.21460 WP_003108953.1.21469 WP_003108953.1.21471 WP_003108953.1.21517 WP_003108953.1.21607 WP_003108953.1.2172 WP_003108953.1.21744 WP_003108953.1.21767 WP_003108953.1.21782 WP_003108953.1.21801 WP_003108953.1.21863 WP_003108953.1.21871 WP_003108953.1.21891 WP_003108953.1.21932 WP_003108953.1.22078 WP_003108953.1.221 WP_003108953.1.2228 WP_003108953.1.22365 WP_003108953.1.22394 WP_003108953.1.22442 WP_003108953.1.22477 WP_003108953.1.22491 WP_003108953.1.22573 WP_003108953.1.22671 WP_003108953.1.22729 WP_003108953.1.22863 WP_003108953.1.2289 WP_003108953.1.22891 WP_003108953.1.23013 WP_003108953.1.23195 WP_003108953.1.2323 WP_003108953.1.23331 WP_003108953.1.23394 WP_003108953.1.23418 WP_003108953.1.23512 WP_003108953.1.23523 WP_003108953.1.23525 WP_003108953.1.2355 WP_003108953.1.23559 WP_003108953.1.23581 WP_003108953.1.236 WP_003108953.1.23641 WP_003108953.1.23715 WP_003108953.1.23739 WP_003108953.1.2374 WP_003108953.1.23769 WP_003108953.1.23794 WP_003108953.1.23884 WP_003108953.1.23925 WP_003108953.1.23938 WP_003108953.1.23961 WP_003108953.1.23967 WP_003108953.1.24066 WP_003108953.1.24087 WP_003108953.1.24101 WP_003108953.1.24183 WP_003108953.1.24234 WP_003108953.1.24319 WP_003108953.1.24351 WP_003108953.1.24382 WP_003108953.1.24413 WP_003108953.1.24447 WP_003108953.1.2453 WP_003108953.1.24626 WP_003108953.1.2477 WP_003108953.1.24851 WP_003108953.1.24862 WP_003108953.1.24869 WP_003108953.1.24879 WP_003108953.1.24938 WP_003108953.1.24940 WP_003108953.1.25052 WP_003108953.1.25075 WP_003108953.1.251 WP_003108953.1.25109 WP_003108953.1.25142 WP_003108953.1.25149 WP_003108953.1.25179 WP_003108953.1.25191 WP_003108953.1.25271 WP_003108953.1.2529 WP_003108953.1.2530 WP_003108953.1.25328 WP_003108953.1.25344 WP_003108953.1.25348 WP_003108953.1.2535 WP_003108953.1.25477 WP_003108953.1.25532 WP_003108953.1.25600 WP_003108953.1.2572 WP_003108953.1.25903 WP_003108953.1.2596 WP_003108953.1.25964 WP_003108953.1.26010 WP_003108953.1.26042 WP_003108953.1.261 WP_003108953.1.26301 WP_003108953.1.26428 WP_003108953.1.26463 WP_003108953.1.26473 WP_003108953.1.26489 WP_003108953.1.26539 WP_003108953.1.26553 WP_003108953.1.26681 WP_003108953.1.26705 WP_003108953.1.26816 WP_003108953.1.26841 WP_003108953.1.26862 WP_003108953.1.26906 WP_003108953.1.26967 WP_003108953.1.27018 WP_003108953.1.27107 WP_003108953.1.27211 WP_003108953.1.27218 WP_003108953.1.27259 WP_003108953.1.27505 WP_003108953.1.27534 WP_003108953.1.27575 WP_003108953.1.27687 WP_003108953.1.27738 WP_003108953.1.27783 WP_003108953.1.27837 WP_003108953.1.27858 WP_003108953.1.27933 WP_003108953.1.27966 WP_003108953.1.28006 WP_003108953.1.28057 WP_003108953.1.28064 WP_003108953.1.28136 WP_003108953.1.28175 WP_003108953.1.28258 WP_003108953.1.283 WP_003108953.1.28329 WP_003108953.1.28372 WP_003108953.1.28382 WP_003108953.1.28383 WP_003108953.1.28468 WP_003108953.1.28528 WP_003108953.1.28560 WP_003108953.1.28602 WP_003108953.1.28757 WP_003108953.1.28800 WP_003108953.1.28838 WP_003108953.1.28849 WP_003108953.1.29003 WP_003108953.1.29062 WP_003108953.1.29096 WP_003108953.1.29127 WP_003108953.1.29137 WP_003108953.1.29158 WP_003108953.1.29179 WP_003108953.1.29208 WP_003108953.1.29438 WP_003108953.1.29440 WP_003108953.1.2948 WP_003108953.1.29498 WP_003108953.1.29501 WP_003108953.1.29577 WP_003108953.1.2961 WP_003108953.1.29668 WP_003108953.1.29753 WP_003108953.1.2980 WP_003108953.1.29973 WP_003108953.1.30081 WP_003108953.1.30365 WP_003108953.1.30474 WP_003108953.1.30475 WP_003108953.1.30563 WP_003108953.1.30567 WP_003108953.1.30615 WP_003108953.1.30625 WP_003108953.1.30707 WP_003108953.1.3072 WP_003108953.1.30740 WP_003108953.1.30797 WP_003108953.1.30815 WP_003108953.1.30886 WP_003108953.1.30943 WP_003108953.1.31076 WP_003108953.1.31087 WP_003108953.1.31103 WP_003108953.1.31105 WP_003108953.1.31138 WP_003108953.1.31147 WP_003108953.1.31279 WP_003108953.1.31361 WP_003108953.1.31457 WP_003108953.1.31501 WP_003108953.1.31563 WP_003108953.1.31655 WP_003108953.1.3172 WP_003108953.1.31732 WP_003108953.1.3179 WP_003108953.1.31852 WP_003108953.1.3189 WP_003108953.1.32134 WP_003108953.1.32137 WP_003108953.1.32144 WP_003108953.1.32314 WP_003108953.1.32359 WP_003108953.1.32447 WP_003108953.1.32523 WP_003108953.1.32544 WP_003108953.1.32596 WP_003108953.1.32869 WP_003108953.1.32879 WP_003108953.1.32998 WP_003108953.1.33009 WP_003108953.1.33047 WP_003108953.1.33133 WP_003108953.1.33152 WP_003108953.1.33210 WP_003108953.1.33216 WP_003108953.1.33294 WP_003108953.1.33340 WP_003108953.1.33387 WP_003108953.1.33438 WP_003108953.1.33441 WP_003108953.1.33455 WP_003108953.1.33517 WP_003108953.1.33547 WP_003108953.1.33549 WP_003108953.1.33653 WP_003108953.1.33658 WP_003108953.1.33669 WP_003108953.1.33733 WP_003108953.1.33734 WP_003108953.1.3376 WP_003108953.1.33774 WP_003108953.1.33801 WP_003108953.1.33814 WP_003108953.1.33822 WP_003108953.1.33824 WP_003108953.1.33833 WP_003108953.1.3385 WP_003108953.1.34000 WP_003108953.1.34136 WP_003108953.1.34203 WP_003108953.1.34324 WP_003108953.1.3436 WP_003108953.1.34401 WP_003108953.1.34402 WP_003108953.1.34465 WP_003108953.1.34472 WP_003108953.1.3452 WP_003108953.1.34556 WP_003108953.1.34568 WP_003108953.1.34583 WP_003108953.1.34689 WP_003108953.1.34784 WP_003108953.1.34832 WP_003108953.1.34836 WP_003108953.1.34837 WP_003108953.1.34876 WP_003108953.1.34878 WP_003108953.1.34901 WP_003108953.1.34922 WP_003108953.1.34942 WP_003108953.1.35104 WP_003108953.1.35149 WP_003108953.1.35231 WP_003108953.1.35281 WP_003108953.1.3531 WP_003108953.1.35353 WP_003108953.1.3540 WP_003108953.1.35431 WP_003108953.1.35442 WP_003108953.1.35480 WP_003108953.1.35512 WP_003108953.1.35573 WP_003108953.1.35639 WP_003108953.1.35641 WP_003108953.1.35679 WP_003108953.1.3568 WP_003108953.1.35682 WP_003108953.1.3576 WP_003108953.1.35762 WP_003108953.1.35768 WP_003108953.1.35822 WP_003108953.1.35843 WP_003108953.1.35857 WP_003108953.1.35872 WP_003108953.1.35968 WP_003108953.1.35984 WP_003108953.1.36064 WP_003108953.1.36148 WP_003108953.1.36170 WP_003108953.1.36267 WP_003108953.1.36378 WP_003108953.1.36435 WP_003108953.1.36487 WP_003108953.1.36521 WP_003108953.1.3653 WP_003108953.1.36587 WP_003108953.1.3662 WP_003108953.1.36665 WP_003108953.1.36708 WP_003108953.1.36756 WP_003108953.1.37163 WP_003108953.1.37208 WP_003108953.1.3721 WP_003108953.1.37216 WP_003108953.1.373 WP_003108953.1.37319 WP_003108953.1.37366 WP_003108953.1.37416 WP_003108953.1.37500 WP_003108953.1.37512 WP_003108953.1.37571 WP_003108953.1.37698 WP_003108953.1.3781 WP_003108953.1.37814 WP_003108953.1.37818 WP_003108953.1.37826 WP_003108953.1.37842 WP_003108953.1.3785 WP_003108953.1.3792 WP_003108953.1.38023 WP_003108953.1.38087 WP_003108953.1.38102 WP_003108953.1.38146 WP_003108953.1.38151 WP_003108953.1.3818 WP_003108953.1.3821 WP_003108953.1.38319 WP_003108953.1.3833 WP_003108953.1.38406 WP_003108953.1.38450 WP_003108953.1.38502 WP_003108953.1.38510 WP_003108953.1.38582 WP_003108953.1.38583 WP_003108953.1.38587 WP_003108953.1.38661 WP_003108953.1.3870 WP_003108953.1.38706 WP_003108953.1.38727 WP_003108953.1.38816 WP_003108953.1.38834 WP_003108953.1.38889 WP_003108953.1.38932 WP_003108953.1.39046 WP_003108953.1.39088 WP_003108953.1.39122 WP_003108953.1.39186 WP_003108953.1.39271 WP_003108953.1.39326 WP_003108953.1.39345 WP_003108953.1.39444 WP_003108953.1.39452 WP_003108953.1.39765 WP_003108953.1.39786 WP_003108953.1.39811 WP_003108953.1.39989 WP_003108953.1.40059 WP_003108953.1.40115 WP_003108953.1.40135 WP_003108953.1.40237 WP_003108953.1.40243 WP_003108953.1.40419 WP_003108953.1.40442 WP_003108953.1.40512 WP_003108953.1.40513 WP_003108953.1.40546 WP_003108953.1.40595 WP_003108953.1.40703 WP_003108953.1.40874 WP_003108953.1.40950 WP_003108953.1.40984 WP_003108953.1.41110 WP_003108953.1.41290 WP_003108953.1.41301 WP_003108953.1.41384 WP_003108953.1.41429 WP_003108953.1.41487 WP_003108953.1.41492 WP_003108953.1.41502 WP_003108953.1.4156 WP_003108953.1.41624 WP_003108953.1.41692 WP_003108953.1.41703 WP_003108953.1.41732 WP_003108953.1.41773 WP_003108953.1.41832 WP_003108953.1.41846 WP_003108953.1.41871 WP_003108953.1.41888 WP_003108953.1.4190 WP_003108953.1.41939 WP_003108953.1.42019 WP_003108953.1.42041 WP_003108953.1.42146 WP_003108953.1.42259 WP_003108953.1.42294 WP_003108953.1.42316 WP_003108953.1.42381 WP_003108953.1.42388 WP_003108953.1.42423 WP_003108953.1.42499 WP_003108953.1.42508 WP_003108953.1.42696 WP_003108953.1.42754 WP_003108953.1.42757 WP_003108953.1.42789 WP_003108953.1.42854 WP_003108953.1.42856 WP_003108953.1.42870 WP_003108953.1.42952 WP_003108953.1.42972 WP_003108953.1.42973 WP_003108953.1.43024 WP_003108953.1.43026 WP_003108953.1.43049 WP_003108953.1.43106 WP_003108953.1.43107 WP_003108953.1.43245 WP_003108953.1.43286 WP_003108953.1.43293 WP_003108953.1.43356 WP_003108953.1.43593 WP_003108953.1.43603 WP_003108953.1.43662 WP_003108953.1.43667 WP_003108953.1.43696 WP_003108953.1.43783 WP_003108953.1.43802 WP_003108953.1.43811 WP_003108953.1.43826 WP_003108953.1.4398 WP_003108953.1.43998 WP_003108953.1.44046 WP_003108953.1.44213 WP_003108953.1.44260 WP_003108953.1.44373 WP_003108953.1.44434 WP_003108953.1.44486 WP_003108953.1.44563 WP_003108953.1.44581 WP_003108953.1.44725 WP_003108953.1.44739 WP_003108953.1.44760 WP_003108953.1.4493 WP_003108953.1.44959 WP_003108953.1.45063 WP_003108953.1.45090 WP_003108953.1.45146 WP_003108953.1.45199 WP_003108953.1.4522 WP_003108953.1.45228 WP_003108953.1.45298 WP_003108953.1.45312 WP_003108953.1.45353 WP_003108953.1.45358 WP_003108953.1.45464 WP_003108953.1.45485 WP_003108953.1.45604 WP_003108953.1.45636 WP_003108953.1.45700 WP_003108953.1.45711 WP_003108953.1.45818 WP_003108953.1.45934 WP_003108953.1.45961 WP_003108953.1.46093 WP_003108953.1.461 WP_003108953.1.46152 WP_003108953.1.46200 WP_003108953.1.46306 WP_003108953.1.46755 WP_003108953.1.46826 WP_003108953.1.46846 WP_003108953.1.46866 WP_003108953.1.46885 WP_003108953.1.46926 WP_003108953.1.46935 WP_003108953.1.47101 WP_003108953.1.47150 WP_003108953.1.47155 WP_003108953.1.47251 WP_003108953.1.4726 WP_003108953.1.47314 WP_003108953.1.47469 WP_003108953.1.47480 WP_003108953.1.47527 WP_003108953.1.47598 WP_003108953.1.47645 WP_003108953.1.47774 WP_003108953.1.47930 WP_003108953.1.47970 WP_003108953.1.48001 WP_003108953.1.48024 WP_003108953.1.48086 WP_003108953.1.48141 WP_003108953.1.48321 WP_003108953.1.4836 WP_003108953.1.48378 WP_003108953.1.48382 WP_003108953.1.48413 WP_003108953.1.48472 WP_003108953.1.48474 WP_003108953.1.48487 WP_003108953.1.48545 WP_003108953.1.48747 WP_003108953.1.48810 WP_003108953.1.48820 WP_003108953.1.48842 WP_003108953.1.48851 WP_003108953.1.48870 WP_003108953.1.48961 WP_003108953.1.49108 WP_003108953.1.49135 WP_003108953.1.49265 WP_003108953.1.49266 WP_003108953.1.49277 WP_003108953.1.49286 WP_003108953.1.49293 WP_003108953.1.49500 WP_003108953.1.49566 WP_003108953.1.49688 WP_003108953.1.49798 WP_003108953.1.49806 WP_003108953.1.49833 WP_003108953.1.49842 WP_003108953.1.49976 WP_003108953.1.49988 WP_003108953.1.49998 WP_003108953.1.50176 WP_003108953.1.50222 WP_003108953.1.5043 WP_003108953.1.50459 WP_003108953.1.50567 WP_003108953.1.50653 WP_003108953.1.50665 WP_003108953.1.50668 WP_003108953.1.50682 WP_003108953.1.50783 WP_003108953.1.50967 WP_003108953.1.50989 WP_003108953.1.51019 WP_003108953.1.51141 WP_003108953.1.51183 WP_003108953.1.51267 WP_003108953.1.5132 WP_003108953.1.51457 WP_003108953.1.51501 WP_003108953.1.51585 WP_003108953.1.51682 WP_003108953.1.51807 WP_003108953.1.51847 WP_003108953.1.51937 WP_003108953.1.51943 WP_003108953.1.51957 WP_003108953.1.52146 WP_003108953.1.52152 WP_003108953.1.52212 WP_003108953.1.52220 WP_003108953.1.52244 WP_003108953.1.52326 WP_003108953.1.52334 WP_003108953.1.52355 WP_003108953.1.52409 WP_003108953.1.52500 WP_003108953.1.52537 WP_003108953.1.5258 WP_003108953.1.52583 WP_003108953.1.52690 WP_003108953.1.52697 WP_003108953.1.52700 WP_003108953.1.52784 WP_003108953.1.52790 WP_003108953.1.52810 WP_003108953.1.52850 WP_003108953.1.53038 WP_003108953.1.53070 WP_003108953.1.53267 WP_003108953.1.53287 WP_003108953.1.53371 WP_003108953.1.53414 WP_003108953.1.53486 WP_003108953.1.53530 WP_003108953.1.53663 WP_003108953.1.53678 WP_003108953.1.53719 WP_003108953.1.53826 WP_003108953.1.53932 WP_003108953.1.53951 WP_003108953.1.54003 WP_003108953.1.54078 WP_003108953.1.54146 WP_003108953.1.54248 WP_003108953.1.5427 WP_003108953.1.54462 WP_003108953.1.54497 WP_003108953.1.54571 WP_003108953.1.54742 WP_003108953.1.54809 WP_003108953.1.54974 WP_003108953.1.55089 WP_003108953.1.55169 WP_003108953.1.55347 WP_003108953.1.55387 WP_003108953.1.55400 WP_003108953.1.55478 WP_003108953.1.55543 WP_003108953.1.55729 WP_003108953.1.55813 WP_003108953.1.56013 WP_003108953.1.56171 WP_003108953.1.56187 WP_003108953.1.56188 WP_003108953.1.56196 WP_003108953.1.56228 WP_003108953.1.56229 WP_003108953.1.56315 WP_003108953.1.56348 WP_003108953.1.56442 WP_003108953.1.56474 WP_003108953.1.56475 WP_003108953.1.56623 WP_003108953.1.56626 WP_003108953.1.56797 WP_003108953.1.56808 WP_003108953.1.56819 WP_003108953.1.56837 WP_003108953.1.56864 WP_003108953.1.56973 WP_003108953.1.57005 WP_003108953.1.57020 WP_003108953.1.57113 WP_003108953.1.57131 WP_003108953.1.57140 WP_003108953.1.57276 WP_003108953.1.5731 WP_003108953.1.57339 WP_003108953.1.57369 WP_003108953.1.57417 WP_003108953.1.57460 WP_003108953.1.57548 WP_003108953.1.57566 WP_003108953.1.57792 WP_003108953.1.57839 WP_003108953.1.57841 WP_003108953.1.57853 WP_003108953.1.57966 WP_003108953.1.58019 WP_003108953.1.58155 WP_003108953.1.58162 WP_003108953.1.58183 WP_003108953.1.58193 WP_003108953.1.58200 WP_003108953.1.58228 WP_003108953.1.58294 WP_003108953.1.58360 WP_003108953.1.58417 WP_003108953.1.58482 WP_003108953.1.5850 WP_003108953.1.58510 WP_003108953.1.58527 WP_003108953.1.5856 WP_003108953.1.58689 WP_003108953.1.5869 WP_003108953.1.58785 WP_003108953.1.58800 WP_003108953.1.5889 WP_003108953.1.58944 WP_003108953.1.59076 WP_003108953.1.59099 WP_003108953.1.59212 WP_003108953.1.5937 WP_003108953.1.59376 WP_003108953.1.594 WP_003108953.1.59469 WP_003108953.1.59563 WP_003108953.1.59688 WP_003108953.1.59724 WP_003108953.1.59759 WP_003108953.1.59797 WP_003108953.1.59831 WP_003108953.1.60079 WP_003108953.1.60082 WP_003108953.1.60084 WP_003108953.1.60085 WP_003108953.1.60206 WP_003108953.1.60261 WP_003108953.1.60364 WP_003108953.1.60396 WP_003108953.1.60415 WP_003108953.1.60467 WP_003108953.1.60472 WP_003108953.1.60602 WP_003108953.1.60603 WP_003108953.1.60686 WP_003108953.1.607 WP_003108953.1.60850 WP_003108953.1.60910 WP_003108953.1.60916 WP_003108953.1.61130 WP_003108953.1.61191 WP_003108953.1.61209 WP_003108953.1.61222 WP_003108953.1.61294 WP_003108953.1.61299 WP_003108953.1.6130 WP_003108953.1.61366 WP_003108953.1.61431 WP_003108953.1.61598 WP_003108953.1.61696 WP_003108953.1.6173 WP_003108953.1.61943 WP_003108953.1.62010 WP_003108953.1.62035 WP_003108953.1.62180 WP_003108953.1.62186 WP_003108953.1.62357 WP_003108953.1.62396 WP_003108953.1.62410 WP_003108953.1.6242 WP_003108953.1.62483 WP_003108953.1.62516 WP_003108953.1.62534 WP_003108953.1.626 WP_003108953.1.62635 WP_003108953.1.62688 WP_003108953.1.62701 WP_003108953.1.62703 WP_003108953.1.62704 WP_003108953.1.62708 WP_003108953.1.62716 WP_003108953.1.62768 WP_003108953.1.62772 WP_003108953.1.6280 WP_003108953.1.6283 WP_003108953.1.62834 WP_003108953.1.62873 WP_003108953.1.62917 WP_003108953.1.62977 WP_003108953.1.63057 WP_003108953.1.63124 WP_003108953.1.63196 WP_003108953.1.63338 WP_003108953.1.63369 WP_003108953.1.63401 WP_003108953.1.63597 WP_003108953.1.63634 WP_003108953.1.63659 WP_003108953.1.63739 WP_003108953.1.63995 WP_003108953.1.64155 WP_003108953.1.64198 WP_003108953.1.64212 WP_003108953.1.64309 WP_003108953.1.64340 WP_003108953.1.64433 WP_003108953.1.6450 WP_003108953.1.64544 WP_003108953.1.64591 WP_003108953.1.64603 WP_003108953.1.6461 WP_003108953.1.64726 WP_003108953.1.64799 WP_003108953.1.64807 WP_003108953.1.64862 WP_003108953.1.64885 WP_003108953.1.64886 WP_003108953.1.64983 WP_003108953.1.64984 WP_003108953.1.65066 WP_003108953.1.65092 WP_003108953.1.65095 WP_003108953.1.65099 WP_003108953.1.65145 WP_003108953.1.65196 WP_003108953.1.65197 WP_003108953.1.65237 WP_003108953.1.65247 WP_003108953.1.65285 WP_003108953.1.65304 WP_003108953.1.65312 WP_003108953.1.65316 WP_003108953.1.65334 WP_003108953.1.65335 WP_003108953.1.65457 WP_003108953.1.65549 WP_003108953.1.65588 WP_003108953.1.65632 WP_003108953.1.65642 WP_003108953.1.65679 WP_003108953.1.65740 WP_003108953.1.65779 WP_003108953.1.65819 WP_003108953.1.65867 WP_003108953.1.65926 WP_003108953.1.66062 WP_003108953.1.66155 WP_003108953.1.66345 WP_003108953.1.66348 WP_003108953.1.66364 WP_003108953.1.66526 WP_003108953.1.66563 WP_003108953.1.66721 WP_003108953.1.66892 WP_003108953.1.66929 WP_003108953.1.66931 WP_003108953.1.66945 WP_003108953.1.66950 WP_003108953.1.67010 WP_003108953.1.67192 WP_003108953.1.67205 WP_003108953.1.67261 WP_003108953.1.6734 WP_003108953.1.67370 WP_003108953.1.67388 WP_003108953.1.67472 WP_003108953.1.67489 WP_003108953.1.67526 WP_003108953.1.67531 WP_003108953.1.67545 WP_003108953.1.67686 WP_003108953.1.67830 WP_003108953.1.67875 WP_003108953.1.67903 WP_003108953.1.68000 WP_003108953.1.6808 WP_003108953.1.68162 WP_003108953.1.68172 WP_003108953.1.68183 WP_003108953.1.68194 WP_003108953.1.68252 WP_003108953.1.68499 WP_003108953.1.6850 WP_003108953.1.68561 WP_003108953.1.68568 WP_003108953.1.68756 WP_003108953.1.68790 WP_003108953.1.68800 WP_003108953.1.68850 WP_003108953.1.68857 WP_003108953.1.68862 WP_003108953.1.68881 WP_003108953.1.68910 WP_003108953.1.68938 WP_003108953.1.68979 WP_003108953.1.69088 WP_003108953.1.6911 WP_003108953.1.69159 WP_003108953.1.69209 WP_003108953.1.69260 WP_003108953.1.6931 WP_003108953.1.6937 WP_003108953.1.69411 WP_003108953.1.69534 WP_003108953.1.69556 WP_003108953.1.69702 WP_003108953.1.69788 WP_003108953.1.69791 WP_003108953.1.69819 WP_003108953.1.69834 WP_003108953.1.69907 WP_003108953.1.69993 WP_003108953.1.70098 WP_003108953.1.70216 WP_003108953.1.70460 WP_003108953.1.70470 WP_003108953.1.70537 WP_003108953.1.70561 WP_003108953.1.70648 WP_003108953.1.70670 WP_003108953.1.7077 WP_003108953.1.70778 WP_003108953.1.70831 WP_003108953.1.71038 WP_003108953.1.71234 WP_003108953.1.71249 WP_003108953.1.71254 WP_003108953.1.7128 WP_003108953.1.71385 WP_003108953.1.71412 WP_003108953.1.71570 WP_003108953.1.7163 WP_003108953.1.71642 WP_003108953.1.71666 WP_003108953.1.71738 WP_003108953.1.71799 WP_003108953.1.71806 WP_003108953.1.71822 WP_003108953.1.71866 WP_003108953.1.71891 WP_003108953.1.71934 WP_003108953.1.72149 WP_003108953.1.72167 WP_003108953.1.72183 WP_003108953.1.72287 WP_003108953.1.72323 WP_003108953.1.72331 WP_003108953.1.72346 WP_003108953.1.72378 WP_003108953.1.72447 WP_003108953.1.72458 WP_003108953.1.72477 WP_003108953.1.72541 WP_003108953.1.72562 WP_003108953.1.72570 WP_003108953.1.72653 WP_003108953.1.72669 WP_003108953.1.72727 WP_003108953.1.7276 WP_003108953.1.72768 WP_003108953.1.72772 WP_003108953.1.72920 WP_003108953.1.73048 WP_003108953.1.73135 WP_003108953.1.73149 WP_003108953.1.73172 WP_003108953.1.73192 WP_003108953.1.7327 WP_003108953.1.7329 WP_003108953.1.73455 WP_003108953.1.73601 WP_003108953.1.73719 WP_003108953.1.73728 WP_003108953.1.7377 WP_003108953.1.7382 WP_003108953.1.73889 WP_003108953.1.73911 WP_003108953.1.73941 WP_003108953.1.74000 WP_003108953.1.74074 WP_003108953.1.7408 WP_003108953.1.74106 WP_003108953.1.74167 WP_003108953.1.74180 WP_003108953.1.74219 WP_003108953.1.74264 WP_003108953.1.74268 WP_003108953.1.74281 WP_003108953.1.74287 WP_003108953.1.74326 WP_003108953.1.74458 WP_003108953.1.74473 WP_003108953.1.7448 WP_003108953.1.7456 WP_003108953.1.74568 WP_003108953.1.74604 WP_003108953.1.74685 WP_003108953.1.74772 WP_003108953.1.748 WP_003108953.1.74941 WP_003108953.1.74948 WP_003108953.1.75041 WP_003108953.1.75303 WP_003108953.1.75431 WP_003108953.1.7547 WP_003108953.1.75549 WP_003108953.1.75573 WP_003108953.1.75580 WP_003108953.1.75603 WP_003108953.1.75631 WP_003108953.1.75771 WP_003108953.1.75792 WP_003108953.1.75825 WP_003108953.1.75860 WP_003108953.1.75938 WP_003108953.1.7595 WP_003108953.1.76077 WP_003108953.1.76092 WP_003108953.1.76141 WP_003108953.1.76145 WP_003108953.1.76322 WP_003108953.1.76355 WP_003108953.1.76383 WP_003108953.1.76441 WP_003108953.1.76484 WP_003108953.1.76543 WP_003108953.1.76600 WP_003108953.1.76633 WP_003108953.1.7666 WP_003108953.1.76716 WP_003108953.1.76775 WP_003108953.1.76861 WP_003108953.1.76922 WP_003108953.1.76985 WP_003108953.1.77235 WP_003108953.1.77286 WP_003108953.1.77317 WP_003108953.1.77490 WP_003108953.1.77574 WP_003108953.1.77587 WP_003108953.1.77686 WP_003108953.1.77750 WP_003108953.1.77769 WP_003108953.1.7779 WP_003108953.1.77834 WP_003108953.1.78112 WP_003108953.1.78118 WP_003108953.1.78134 WP_003108953.1.78148 WP_003108953.1.78158 WP_003108953.1.78280 WP_003108953.1.78288 WP_003108953.1.7840 WP_003108953.1.78409 WP_003108953.1.78430 WP_003108953.1.78437 WP_003108953.1.78570 WP_003108953.1.78623 WP_003108953.1.78669 WP_003108953.1.78693 WP_003108953.1.78926 WP_003108953.1.78947 WP_003108953.1.78954 WP_003108953.1.78986 WP_003108953.1.79007 WP_003108953.1.79177 WP_003108953.1.79193 WP_003108953.1.79256 WP_003108953.1.79286 WP_003108953.1.79311 WP_003108953.1.79357 WP_003108953.1.79364 WP_003108953.1.79421 WP_003108953.1.79429 WP_003108953.1.7945 WP_003108953.1.79507 WP_003108953.1.7953 WP_003108953.1.79569 WP_003108953.1.79601 WP_003108953.1.79631 WP_003108953.1.79754 WP_003108953.1.79788 WP_003108953.1.79902 WP_003108953.1.79908 WP_003108953.1.79986 WP_003108953.1.80033 WP_003108953.1.8013 WP_003108953.1.80258 WP_003108953.1.8028 WP_003108953.1.8038 WP_003108953.1.80410 WP_003108953.1.80411 WP_003108953.1.80454 WP_003108953.1.80481 WP_003108953.1.8051 WP_003108953.1.80535 WP_003108953.1.80627 WP_003108953.1.80632 WP_003108953.1.8064 WP_003108953.1.80645 WP_003108953.1.80683 WP_003108953.1.80720 WP_003108953.1.80785 WP_003108953.1.80846 WP_003108953.1.80880 WP_003108953.1.80910 WP_003108953.1.80929 WP_003108953.1.81082 WP_003108953.1.8110 WP_003108953.1.81206 WP_003108953.1.81368 WP_003108953.1.81380 WP_003108953.1.81426 WP_003108953.1.81470 WP_003108953.1.81482 WP_003108953.1.81487 WP_003108953.1.81581 WP_003108953.1.81622 WP_003108953.1.81708 WP_003108953.1.81748 WP_003108953.1.81771 WP_003108953.1.81784 WP_003108953.1.81802 WP_003108953.1.81844 WP_003108953.1.81856 WP_003108953.1.81874 WP_003108953.1.81927 WP_003108953.1.81950 WP_003108953.1.81957 WP_003108953.1.81960 WP_003108953.1.81986 WP_003108953.1.82117 WP_003108953.1.82127 WP_003108953.1.82178 WP_003108953.1.8227 WP_003108953.1.82312 WP_003108953.1.82334 WP_003108953.1.82442 WP_003108953.1.82487 WP_003108953.1.82580 WP_003108953.1.82606 WP_003108953.1.82620 WP_003108953.1.82643 WP_003108953.1.82710 WP_003108953.1.82864 WP_003108953.1.82887 WP_003108953.1.82936 WP_003108953.1.83025 WP_003108953.1.83131 WP_003108953.1.83184 WP_003108953.1.83251 WP_003108953.1.83267 WP_003108953.1.83296 WP_003108953.1.83317 WP_003108953.1.83374 WP_003108953.1.83394 WP_003108953.1.83440 WP_003108953.1.83460 WP_003108953.1.83463 WP_003108953.1.835 WP_003108953.1.83503 WP_003108953.1.8353 WP_003108953.1.83534 WP_003108953.1.83540 WP_003108953.1.83637 WP_003108953.1.83698 WP_003108953.1.83715 WP_003108953.1.84008 WP_003108953.1.84138 WP_003108953.1.84162 WP_003108953.1.84174 WP_003108953.1.84177 WP_003108953.1.84190 WP_003108953.1.84203 WP_003108953.1.84271 WP_003108953.1.84297 WP_003108953.1.8437 WP_003108953.1.84374 WP_003108953.1.84398 WP_003108953.1.84404 WP_003108953.1.84471 WP_003108953.1.84526 WP_003108953.1.8453 WP_003108953.1.84538 WP_003108953.1.84558 WP_003108953.1.84589 WP_003108953.1.84674 WP_003108953.1.84684 WP_003108953.1.84715 WP_003108953.1.84754 WP_003108953.1.84792 WP_003108953.1.84937 WP_003108953.1.85018 WP_003108953.1.85059 WP_003108953.1.85150 WP_003108953.1.85220 WP_003108953.1.85298 WP_003108953.1.85303 WP_003108953.1.85318 WP_003108953.1.85357 WP_003108953.1.85446 WP_003108953.1.85453 WP_003108953.1.85633 WP_003108953.1.85638 WP_003108953.1.85788 WP_003108953.1.85897 WP_003108953.1.85910 WP_003108953.1.85920 WP_003108953.1.86002 WP_003108953.1.86047 WP_003108953.1.86055 WP_003108953.1.86058 WP_003108953.1.861 WP_003108953.1.86125 WP_003108953.1.86182 WP_003108953.1.86278 WP_003108953.1.86287 WP_003108953.1.86293 WP_003108953.1.865 WP_003108953.1.86545 WP_003108953.1.86552 WP_003108953.1.86554 WP_003108953.1.86665 WP_003108953.1.867 WP_003108953.1.86708 WP_003108953.1.86733 WP_003108953.1.86774 WP_003108953.1.86780 WP_003108953.1.86785 WP_003108953.1.86796 WP_003108953.1.86970 WP_003108953.1.86985 WP_003108953.1.87163 WP_003108953.1.8718 WP_003108953.1.87182 WP_003108953.1.87183 WP_003108953.1.87316 WP_003108953.1.87390 WP_003108953.1.87435 WP_003108953.1.87463 WP_003108953.1.8749 WP_003108953.1.87530 WP_003108953.1.87547 WP_003108953.1.8777 WP_003108953.1.8785 WP_003108953.1.87888 WP_003108953.1.87970 WP_003108953.1.87981 WP_003108953.1.87987 WP_003108953.1.88004 WP_003108953.1.88330 WP_003108953.1.88360 WP_003108953.1.88415 WP_003108953.1.8852 WP_003108953.1.88540 WP_003108953.1.88550 WP_003108953.1.88578 WP_003108953.1.88605 WP_003108953.1.88680 WP_003108953.1.88714 WP_003108953.1.88750 WP_003108953.1.889 WP_003108953.1.88949 WP_003108953.1.88969 WP_003108953.1.89083 WP_003108953.1.89234 WP_003108953.1.89245 WP_003108953.1.89266 WP_003108953.1.89330 WP_003108953.1.89434 WP_003108953.1.89480 WP_003108953.1.8949 WP_003108953.1.89491 WP_003108953.1.89523 WP_003108953.1.89577 WP_003108953.1.89610 WP_003108953.1.89638 WP_003108953.1.89662 WP_003108953.1.89669 WP_003108953.1.89736 WP_003108953.1.8976 WP_003108953.1.89805 WP_003108953.1.89866 WP_003108953.1.89867 WP_003108953.1.89871 WP_003108953.1.89886 WP_003108953.1.89992 WP_003108953.1.90024 WP_003108953.1.90032 WP_003108953.1.90110 WP_003108953.1.90141 WP_003108953.1.90150 WP_003108953.1.90189 WP_003108953.1.90225 WP_003108953.1.90242 WP_003108953.1.90268 WP_003108953.1.90306 WP_003108953.1.90412 WP_003108953.1.90569 WP_003108953.1.90770 WP_003108953.1.90999 WP_003108953.1.91093 WP_003108953.1.9120 WP_003108953.1.91204 WP_003108953.1.91281 WP_003108953.1.91336 WP_003108953.1.91392 WP_003108953.1.91416 WP_003108953.1.9143 WP_003108953.1.91431 WP_003108953.1.91438 WP_003108953.1.91467 WP_003108953.1.91527 WP_003108953.1.91585 WP_003108953.1.91796 WP_003108953.1.91803 WP_003108953.1.9182 WP_003108953.1.91838 WP_003108953.1.91860 WP_003108953.1.91862 WP_003108953.1.92175 WP_003108953.1.9219 WP_003108953.1.92321 WP_003108953.1.92357 WP_003108953.1.92454 WP_003108953.1.92573 WP_003108953.1.92589 WP_003108953.1.92594 WP_003108953.1.92624 WP_003108953.1.92630 WP_003108953.1.92642 WP_003108953.1.9272 WP_003108953.1.92769 WP_003108953.1.92839 WP_003108953.1.92847 WP_003108953.1.92924 WP_003108953.1.92930 WP_003108953.1.93001 WP_003108953.1.93090 WP_003108953.1.93148 WP_003108953.1.93250 WP_003108953.1.9328 WP_003108953.1.9349 WP_003108953.1.93493 WP_003108953.1.93498 WP_003108953.1.93547 WP_003108953.1.93562 WP_003108953.1.93568 WP_003108953.1.93797 WP_003108953.1.93848 WP_003108953.1.93889 WP_003108953.1.93897 WP_003108953.1.94004 WP_003108953.1.94031 WP_003108953.1.94065 WP_003108953.1.94078 WP_003108953.1.94136 WP_003108953.1.94174 WP_003108953.1.94211 WP_003108953.1.94218 WP_003108953.1.94230 WP_003108953.1.94243 WP_003108953.1.94285 WP_003108953.1.94333 WP_003108953.1.94385 WP_003108953.1.94434 WP_003108953.1.9444 WP_003108953.1.94450 WP_003108953.1.94682 WP_003108953.1.94732 WP_003108953.1.94742 WP_003108953.1.94856 WP_003108953.1.94874 WP_003108953.1.94896 WP_003108953.1.94897 WP_003108953.1.94943 WP_003108953.1.95018 WP_003108953.1.95025 WP_003108953.1.95027 WP_003108953.1.95117 WP_003108953.1.95187 WP_003108953.1.95207 WP_003108953.1.95305 WP_003108953.1.95324 WP_003108953.1.95359 WP_003108953.1.95460 WP_003108953.1.95488 WP_003108953.1.95525 WP_003108953.1.95536 WP_003108953.1.95638 WP_003108953.1.95668 WP_003108953.1.95774 WP_003108953.1.95782 WP_003108953.1.95787 WP_003108953.1.95802 WP_003108953.1.95820 WP_003108953.1.95825 WP_003108953.1.9599 WP_003108953.1.96041 WP_003108953.1.96058 WP_003108953.1.961 WP_003108953.1.96134 WP_003108953.1.96243 WP_003108953.1.96267 WP_003108953.1.96357 WP_003108953.1.96384 WP_003108953.1.96452 WP_003108953.1.96667 WP_003108953.1.96714 WP_003108953.1.96880 WP_003108953.1.9706 WP_003108953.1.97118 WP_003108953.1.97126 WP_003108953.1.97204 WP_003108953.1.97213 WP_003108953.1.9722 WP_003108953.1.97271 WP_003108953.1.97377 WP_003108953.1.97461 WP_003108953.1.97474 WP_003108953.1.97499 WP_003108953.1.97583 WP_003108953.1.97614 WP_003108953.1.977 WP_003108953.1.97826 WP_003108953.1.97968 WP_003108953.1.98111 WP_003108953.1.98260 WP_003108953.1.98276 WP_003108953.1.98308 WP_003108953.1.98410 WP_003108953.1.98414 WP_003108953.1.985 WP_003108953.1.98515 WP_003108953.1.98522 WP_003108953.1.98600 WP_003108953.1.98610 WP_003108953.1.98814 WP_003108953.1.9885 WP_003108953.1.98873 WP_003108953.1.98958 WP_003108953.1.99065 WP_003108953.1.99068 WP_003108953.1.99103 WP_003108953.1.99214 WP_003108953.1.99293 WP_003108953.1.99378 WP_003108953.1.99386 WP_003108953.1.99389 WP_003108953.1.99461 WP_003108953.1.9951 WP_003108953.1.99516 WP_003108953.1.99647 WP_003108953.1.99757 WP_003108953.1.99772 WP_003108953.1.99795 WP_003108953.1.99835 WP_003108953.1.9989 WP_003108953.1.99930 gi|478478357|ref|YP_007709008.1| gi|392983472|ref|YP_006482059.1| 208964.PA2813 557722.PLES_22591 gi|218890996|ref|YP_002439862.1| gi|514410091|ref|YP_008133434.1| gi|386058213|ref|YP_005974735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]