SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153588|ref|YP_008942558.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153588|ref|YP_008942558.1|
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 5.65e-38
Family Globins 0.0000512
Further Details:      
 
Domain Number 2 Region: 255-388
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.63e-33
Family Flavohemoglobin, C-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 151-253
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.02e-30
Family Ferredoxin reductase FAD-binding domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568153588|ref|YP_008942558.1|
Sequence length 393
Comment dihydropteridine reductase [Pseudomonas aeruginosa LES431]
Sequence
MLSNAQRALIKATVPLLETGGEALITHFYRTMLGEYPEVRPLFNQAHQASGDQPRALANG
VLMYARHIDQLQELGPLVAKVVNKHVSLQVLPEHYPIVGTCLLRAIREVLGEQIATDEVL
EAWGAAYQQLADLLIEAEESVYAASAQAEGGWRGVRRFRVARKQAESEEITSFYLEPVDG
QPLLAFQPGQYIGLRLDIDGEEVRRNYSLSAASNGREYRISVKREAGGRVSNYLHDRVAE
GDELDLFPPAGDFVLRDSDKPLVLITAGVGITPALAMLQEALPQARPIRFIHCARHGGVH
AFRDWIEDVSAQHEQVEHFFCYSEPRAGDSADAEGLLSREKLADWLPQERDLDAYFLGPR
PFMAQVKRHLADLGVPSQQCHYEFFGPAAALDA
Download sequence
Identical sequences A0A0C7CYC8 A0A1E9D544
WP_003097711.1.100071 WP_003097711.1.100179 WP_003097711.1.100394 WP_003097711.1.100420 WP_003097711.1.100723 WP_003097711.1.100777 WP_003097711.1.100809 WP_003097711.1.100810 WP_003097711.1.100995 WP_003097711.1.101021 WP_003097711.1.101090 WP_003097711.1.101506 WP_003097711.1.101642 WP_003097711.1.10204 WP_003097711.1.102045 WP_003097711.1.10407 WP_003097711.1.10419 WP_003097711.1.10457 WP_003097711.1.10513 WP_003097711.1.10529 WP_003097711.1.10572 WP_003097711.1.10641 WP_003097711.1.10684 WP_003097711.1.10856 WP_003097711.1.10949 WP_003097711.1.11026 WP_003097711.1.11077 WP_003097711.1.1109 WP_003097711.1.11163 WP_003097711.1.11178 WP_003097711.1.11388 WP_003097711.1.11653 WP_003097711.1.11744 WP_003097711.1.11754 WP_003097711.1.1180 WP_003097711.1.11847 WP_003097711.1.11943 WP_003097711.1.12302 WP_003097711.1.12482 WP_003097711.1.12561 WP_003097711.1.12657 WP_003097711.1.12670 WP_003097711.1.12687 WP_003097711.1.12873 WP_003097711.1.12891 WP_003097711.1.12934 WP_003097711.1.12970 WP_003097711.1.13 WP_003097711.1.1305 WP_003097711.1.13208 WP_003097711.1.13232 WP_003097711.1.13242 WP_003097711.1.1333 WP_003097711.1.13529 WP_003097711.1.1356 WP_003097711.1.1362 WP_003097711.1.13622 WP_003097711.1.13765 WP_003097711.1.13865 WP_003097711.1.14049 WP_003097711.1.14204 WP_003097711.1.14424 WP_003097711.1.14463 WP_003097711.1.14640 WP_003097711.1.14714 WP_003097711.1.1475 WP_003097711.1.14820 WP_003097711.1.14835 WP_003097711.1.14966 WP_003097711.1.15130 WP_003097711.1.15222 WP_003097711.1.15297 WP_003097711.1.15373 WP_003097711.1.15474 WP_003097711.1.15482 WP_003097711.1.15485 WP_003097711.1.15889 WP_003097711.1.16074 WP_003097711.1.16109 WP_003097711.1.16142 WP_003097711.1.16161 WP_003097711.1.16239 WP_003097711.1.16242 WP_003097711.1.16279 WP_003097711.1.16419 WP_003097711.1.1646 WP_003097711.1.16660 WP_003097711.1.1671 WP_003097711.1.16808 WP_003097711.1.17162 WP_003097711.1.17370 WP_003097711.1.17397 WP_003097711.1.17566 WP_003097711.1.17883 WP_003097711.1.18052 WP_003097711.1.1824 WP_003097711.1.18852 WP_003097711.1.18911 WP_003097711.1.18930 WP_003097711.1.190 WP_003097711.1.19269 WP_003097711.1.1938 WP_003097711.1.19552 WP_003097711.1.19591 WP_003097711.1.1971 WP_003097711.1.19771 WP_003097711.1.20125 WP_003097711.1.20216 WP_003097711.1.20744 WP_003097711.1.20764 WP_003097711.1.20854 WP_003097711.1.20884 WP_003097711.1.209 WP_003097711.1.20929 WP_003097711.1.21100 WP_003097711.1.21166 WP_003097711.1.21242 WP_003097711.1.21302 WP_003097711.1.21349 WP_003097711.1.21358 WP_003097711.1.2144 WP_003097711.1.21448 WP_003097711.1.21460 WP_003097711.1.21517 WP_003097711.1.21607 WP_003097711.1.2172 WP_003097711.1.21801 WP_003097711.1.21932 WP_003097711.1.22324 WP_003097711.1.22671 WP_003097711.1.22863 WP_003097711.1.2289 WP_003097711.1.22891 WP_003097711.1.23195 WP_003097711.1.23512 WP_003097711.1.23581 WP_003097711.1.236 WP_003097711.1.23641 WP_003097711.1.23715 WP_003097711.1.23739 WP_003097711.1.23782 WP_003097711.1.23961 WP_003097711.1.24351 WP_003097711.1.24851 WP_003097711.1.25033 WP_003097711.1.251 WP_003097711.1.25142 WP_003097711.1.25149 WP_003097711.1.25328 WP_003097711.1.25344 WP_003097711.1.25348 WP_003097711.1.2535 WP_003097711.1.25532 WP_003097711.1.25600 WP_003097711.1.2572 WP_003097711.1.25903 WP_003097711.1.261 WP_003097711.1.26539 WP_003097711.1.26841 WP_003097711.1.26967 WP_003097711.1.27018 WP_003097711.1.27107 WP_003097711.1.27218 WP_003097711.1.27505 WP_003097711.1.27534 WP_003097711.1.27575 WP_003097711.1.27738 WP_003097711.1.27837 WP_003097711.1.27939 WP_003097711.1.28006 WP_003097711.1.28175 WP_003097711.1.28258 WP_003097711.1.283 WP_003097711.1.28329 WP_003097711.1.28404 WP_003097711.1.28468 WP_003097711.1.28800 WP_003097711.1.28849 WP_003097711.1.29062 WP_003097711.1.29158 WP_003097711.1.29179 WP_003097711.1.29208 WP_003097711.1.29472 WP_003097711.1.2948 WP_003097711.1.29501 WP_003097711.1.29668 WP_003097711.1.29848 WP_003097711.1.30000 WP_003097711.1.30474 WP_003097711.1.30567 WP_003097711.1.30614 WP_003097711.1.30707 WP_003097711.1.30740 WP_003097711.1.30797 WP_003097711.1.30815 WP_003097711.1.30886 WP_003097711.1.31045 WP_003097711.1.31076 WP_003097711.1.31087 WP_003097711.1.31103 WP_003097711.1.31105 WP_003097711.1.31138 WP_003097711.1.31147 WP_003097711.1.31279 WP_003097711.1.31501 WP_003097711.1.31565 WP_003097711.1.31939 WP_003097711.1.32137 WP_003097711.1.32314 WP_003097711.1.32523 WP_003097711.1.32544 WP_003097711.1.32596 WP_003097711.1.32711 WP_003097711.1.33133 WP_003097711.1.33152 WP_003097711.1.33210 WP_003097711.1.33216 WP_003097711.1.33521 WP_003097711.1.33549 WP_003097711.1.33658 WP_003097711.1.33733 WP_003097711.1.33734 WP_003097711.1.33822 WP_003097711.1.34000 WP_003097711.1.34191 WP_003097711.1.34324 WP_003097711.1.34402 WP_003097711.1.3452 WP_003097711.1.34568 WP_003097711.1.34625 WP_003097711.1.34832 WP_003097711.1.34876 WP_003097711.1.34922 WP_003097711.1.34942 WP_003097711.1.35281 WP_003097711.1.35325 WP_003097711.1.35353 WP_003097711.1.3540 WP_003097711.1.35431 WP_003097711.1.35512 WP_003097711.1.35573 WP_003097711.1.35641 WP_003097711.1.35679 WP_003097711.1.3568 WP_003097711.1.35682 WP_003097711.1.3576 WP_003097711.1.35768 WP_003097711.1.35822 WP_003097711.1.35857 WP_003097711.1.35872 WP_003097711.1.36170 WP_003097711.1.36487 WP_003097711.1.36587 WP_003097711.1.3662 WP_003097711.1.36630 WP_003097711.1.36665 WP_003097711.1.36781 WP_003097711.1.37163 WP_003097711.1.3721 WP_003097711.1.37366 WP_003097711.1.37512 WP_003097711.1.3781 WP_003097711.1.37814 WP_003097711.1.37842 WP_003097711.1.38003 WP_003097711.1.38102 WP_003097711.1.38146 WP_003097711.1.38151 WP_003097711.1.3833 WP_003097711.1.38406 WP_003097711.1.38502 WP_003097711.1.38583 WP_003097711.1.38661 WP_003097711.1.38727 WP_003097711.1.38834 WP_003097711.1.38889 WP_003097711.1.39088 WP_003097711.1.39186 WP_003097711.1.39271 WP_003097711.1.39345 WP_003097711.1.39444 WP_003097711.1.39786 WP_003097711.1.3998 WP_003097711.1.40059 WP_003097711.1.40243 WP_003097711.1.40512 WP_003097711.1.40513 WP_003097711.1.40541 WP_003097711.1.40595 WP_003097711.1.40703 WP_003097711.1.41291 WP_003097711.1.41301 WP_003097711.1.41492 WP_003097711.1.4156 WP_003097711.1.41618 WP_003097711.1.41624 WP_003097711.1.41625 WP_003097711.1.41692 WP_003097711.1.41732 WP_003097711.1.41832 WP_003097711.1.41888 WP_003097711.1.4190 WP_003097711.1.41939 WP_003097711.1.42041 WP_003097711.1.42146 WP_003097711.1.42423 WP_003097711.1.42696 WP_003097711.1.42754 WP_003097711.1.42757 WP_003097711.1.42789 WP_003097711.1.42856 WP_003097711.1.42917 WP_003097711.1.43293 WP_003097711.1.43662 WP_003097711.1.43667 WP_003097711.1.43673 WP_003097711.1.43811 WP_003097711.1.43826 WP_003097711.1.44046 WP_003097711.1.44213 WP_003097711.1.44260 WP_003097711.1.44563 WP_003097711.1.44581 WP_003097711.1.44959 WP_003097711.1.45090 WP_003097711.1.45146 WP_003097711.1.45199 WP_003097711.1.4522 WP_003097711.1.45312 WP_003097711.1.45464 WP_003097711.1.45485 WP_003097711.1.45711 WP_003097711.1.45934 WP_003097711.1.45961 WP_003097711.1.461 WP_003097711.1.46152 WP_003097711.1.46200 WP_003097711.1.46436 WP_003097711.1.46623 WP_003097711.1.46755 WP_003097711.1.46846 WP_003097711.1.46926 WP_003097711.1.47101 WP_003097711.1.47150 WP_003097711.1.47158 WP_003097711.1.47251 WP_003097711.1.47312 WP_003097711.1.47469 WP_003097711.1.47480 WP_003097711.1.47598 WP_003097711.1.47774 WP_003097711.1.47970 WP_003097711.1.48001 WP_003097711.1.48086 WP_003097711.1.48094 WP_003097711.1.48321 WP_003097711.1.48334 WP_003097711.1.4836 WP_003097711.1.48378 WP_003097711.1.48747 WP_003097711.1.48820 WP_003097711.1.48842 WP_003097711.1.48870 WP_003097711.1.49265 WP_003097711.1.49277 WP_003097711.1.49360 WP_003097711.1.49688 WP_003097711.1.49798 WP_003097711.1.49976 WP_003097711.1.50176 WP_003097711.1.50180 WP_003097711.1.50222 WP_003097711.1.50242 WP_003097711.1.5043 WP_003097711.1.50665 WP_003097711.1.50668 WP_003097711.1.50682 WP_003097711.1.51019 WP_003097711.1.51457 WP_003097711.1.51807 WP_003097711.1.51889 WP_003097711.1.52146 WP_003097711.1.52152 WP_003097711.1.52220 WP_003097711.1.52244 WP_003097711.1.5235 WP_003097711.1.52537 WP_003097711.1.5258 WP_003097711.1.52583 WP_003097711.1.5260 WP_003097711.1.52690 WP_003097711.1.52700 WP_003097711.1.52784 WP_003097711.1.52810 WP_003097711.1.5294 WP_003097711.1.53169 WP_003097711.1.53427 WP_003097711.1.53719 WP_003097711.1.53826 WP_003097711.1.53932 WP_003097711.1.54078 WP_003097711.1.54133 WP_003097711.1.54140 WP_003097711.1.54248 WP_003097711.1.54497 WP_003097711.1.54742 WP_003097711.1.54809 WP_003097711.1.55089 WP_003097711.1.55169 WP_003097711.1.55478 WP_003097711.1.56013 WP_003097711.1.56145 WP_003097711.1.56171 WP_003097711.1.56188 WP_003097711.1.56315 WP_003097711.1.56348 WP_003097711.1.56452 WP_003097711.1.56475 WP_003097711.1.56632 WP_003097711.1.56768 WP_003097711.1.56797 WP_003097711.1.56808 WP_003097711.1.56819 WP_003097711.1.56973 WP_003097711.1.57005 WP_003097711.1.57140 WP_003097711.1.57276 WP_003097711.1.57460 WP_003097711.1.57480 WP_003097711.1.57566 WP_003097711.1.57839 WP_003097711.1.58155 WP_003097711.1.58162 WP_003097711.1.58183 WP_003097711.1.58193 WP_003097711.1.58294 WP_003097711.1.58689 WP_003097711.1.58785 WP_003097711.1.59076 WP_003097711.1.59246 WP_003097711.1.59249 WP_003097711.1.59250 WP_003097711.1.5937 WP_003097711.1.594 WP_003097711.1.59469 WP_003097711.1.59563 WP_003097711.1.59831 WP_003097711.1.59870 WP_003097711.1.60082 WP_003097711.1.60085 WP_003097711.1.60415 WP_003097711.1.60602 WP_003097711.1.60603 WP_003097711.1.60639 WP_003097711.1.60686 WP_003097711.1.607 WP_003097711.1.60916 WP_003097711.1.61130 WP_003097711.1.61191 WP_003097711.1.61209 WP_003097711.1.61299 WP_003097711.1.6130 WP_003097711.1.61366 WP_003097711.1.61549 WP_003097711.1.61598 WP_003097711.1.61696 WP_003097711.1.6173 WP_003097711.1.62396 WP_003097711.1.62483 WP_003097711.1.62516 WP_003097711.1.62534 WP_003097711.1.62701 WP_003097711.1.62704 WP_003097711.1.62768 WP_003097711.1.6280 WP_003097711.1.62873 WP_003097711.1.63196 WP_003097711.1.63338 WP_003097711.1.63369 WP_003097711.1.63597 WP_003097711.1.64799 WP_003097711.1.64807 WP_003097711.1.64862 WP_003097711.1.64880 WP_003097711.1.64984 WP_003097711.1.65099 WP_003097711.1.65145 WP_003097711.1.65196 WP_003097711.1.65197 WP_003097711.1.65227 WP_003097711.1.65335 WP_003097711.1.65549 WP_003097711.1.65588 WP_003097711.1.65642 WP_003097711.1.65819 WP_003097711.1.65926 WP_003097711.1.66062 WP_003097711.1.66165 WP_003097711.1.66277 WP_003097711.1.66345 WP_003097711.1.66526 WP_003097711.1.66634 WP_003097711.1.66721 WP_003097711.1.66929 WP_003097711.1.66950 WP_003097711.1.67010 WP_003097711.1.67205 WP_003097711.1.67261 WP_003097711.1.6734 WP_003097711.1.67370 WP_003097711.1.67388 WP_003097711.1.67472 WP_003097711.1.67526 WP_003097711.1.67686 WP_003097711.1.67830 WP_003097711.1.68000 WP_003097711.1.6808 WP_003097711.1.68158 WP_003097711.1.68183 WP_003097711.1.68252 WP_003097711.1.68317 WP_003097711.1.68561 WP_003097711.1.68568 WP_003097711.1.68638 WP_003097711.1.68756 WP_003097711.1.68850 WP_003097711.1.68862 WP_003097711.1.68938 WP_003097711.1.69159 WP_003097711.1.69260 WP_003097711.1.6928 WP_003097711.1.6931 WP_003097711.1.6937 WP_003097711.1.69599 WP_003097711.1.69702 WP_003097711.1.69791 WP_003097711.1.69907 WP_003097711.1.69993 WP_003097711.1.70561 WP_003097711.1.70648 WP_003097711.1.7077 WP_003097711.1.70778 WP_003097711.1.70831 WP_003097711.1.70991 WP_003097711.1.71038 WP_003097711.1.7128 WP_003097711.1.71570 WP_003097711.1.72167 WP_003097711.1.72287 WP_003097711.1.72323 WP_003097711.1.72331 WP_003097711.1.72346 WP_003097711.1.72378 WP_003097711.1.72447 WP_003097711.1.72541 WP_003097711.1.72669 WP_003097711.1.72768 WP_003097711.1.72772 WP_003097711.1.73048 WP_003097711.1.73149 WP_003097711.1.7327 WP_003097711.1.7329 WP_003097711.1.73541 WP_003097711.1.7382 WP_003097711.1.73860 WP_003097711.1.73889 WP_003097711.1.73911 WP_003097711.1.74074 WP_003097711.1.74167 WP_003097711.1.74175 WP_003097711.1.74180 WP_003097711.1.74219 WP_003097711.1.74264 WP_003097711.1.74458 WP_003097711.1.74473 WP_003097711.1.74518 WP_003097711.1.74568 WP_003097711.1.74629 WP_003097711.1.74772 WP_003097711.1.748 WP_003097711.1.75041 WP_003097711.1.75277 WP_003097711.1.7547 WP_003097711.1.75549 WP_003097711.1.75573 WP_003097711.1.75771 WP_003097711.1.75792 WP_003097711.1.75825 WP_003097711.1.75860 WP_003097711.1.75935 WP_003097711.1.7595 WP_003097711.1.76355 WP_003097711.1.76467 WP_003097711.1.76600 WP_003097711.1.7666 WP_003097711.1.76716 WP_003097711.1.76922 WP_003097711.1.76985 WP_003097711.1.77235 WP_003097711.1.77317 WP_003097711.1.77686 WP_003097711.1.77750 WP_003097711.1.77769 WP_003097711.1.78280 WP_003097711.1.78430 WP_003097711.1.78570 WP_003097711.1.78669 WP_003097711.1.78926 WP_003097711.1.79007 WP_003097711.1.79177 WP_003097711.1.79193 WP_003097711.1.79279 WP_003097711.1.79311 WP_003097711.1.79357 WP_003097711.1.79431 WP_003097711.1.79463 WP_003097711.1.7953 WP_003097711.1.79569 WP_003097711.1.79788 WP_003097711.1.79862 WP_003097711.1.80033 WP_003097711.1.80410 WP_003097711.1.8064 WP_003097711.1.80644 WP_003097711.1.80645 WP_003097711.1.80892 WP_003097711.1.80929 WP_003097711.1.81591 WP_003097711.1.81728 WP_003097711.1.81748 WP_003097711.1.81834 WP_003097711.1.81844 WP_003097711.1.81950 WP_003097711.1.82117 WP_003097711.1.82127 WP_003097711.1.82178 WP_003097711.1.82260 WP_003097711.1.8227 WP_003097711.1.82310 WP_003097711.1.82328 WP_003097711.1.82442 WP_003097711.1.82487 WP_003097711.1.82580 WP_003097711.1.82604 WP_003097711.1.82643 WP_003097711.1.82710 WP_003097711.1.82887 WP_003097711.1.83025 WP_003097711.1.83184 WP_003097711.1.83213 WP_003097711.1.83251 WP_003097711.1.83296 WP_003097711.1.83394 WP_003097711.1.83463 WP_003097711.1.835 WP_003097711.1.8353 WP_003097711.1.8357 WP_003097711.1.84003 WP_003097711.1.84008 WP_003097711.1.84162 WP_003097711.1.84190 WP_003097711.1.84297 WP_003097711.1.84374 WP_003097711.1.84398 WP_003097711.1.84439 WP_003097711.1.8453 WP_003097711.1.84674 WP_003097711.1.84702 WP_003097711.1.8484 WP_003097711.1.85298 WP_003097711.1.85303 WP_003097711.1.85318 WP_003097711.1.85357 WP_003097711.1.85446 WP_003097711.1.85788 WP_003097711.1.85897 WP_003097711.1.85910 WP_003097711.1.86055 WP_003097711.1.86278 WP_003097711.1.86386 WP_003097711.1.86545 WP_003097711.1.86552 WP_003097711.1.86652 WP_003097711.1.86774 WP_003097711.1.86780 WP_003097711.1.86785 WP_003097711.1.86947 WP_003097711.1.8718 WP_003097711.1.87183 WP_003097711.1.8727 WP_003097711.1.87435 WP_003097711.1.87530 WP_003097711.1.88360 WP_003097711.1.8852 WP_003097711.1.88605 WP_003097711.1.88659 WP_003097711.1.88679 WP_003097711.1.88714 WP_003097711.1.88969 WP_003097711.1.89083 WP_003097711.1.8911 WP_003097711.1.89577 WP_003097711.1.89662 WP_003097711.1.89736 WP_003097711.1.89776 WP_003097711.1.89805 WP_003097711.1.89866 WP_003097711.1.90110 WP_003097711.1.90224 WP_003097711.1.90242 WP_003097711.1.90268 WP_003097711.1.90306 WP_003097711.1.90412 WP_003097711.1.90569 WP_003097711.1.90655 WP_003097711.1.90770 WP_003097711.1.90940 WP_003097711.1.90999 WP_003097711.1.91093 WP_003097711.1.9120 WP_003097711.1.91204 WP_003097711.1.91336 WP_003097711.1.9143 WP_003097711.1.91431 WP_003097711.1.91438 WP_003097711.1.91563 WP_003097711.1.91585 WP_003097711.1.91838 WP_003097711.1.9191 WP_003097711.1.92573 WP_003097711.1.92587 WP_003097711.1.92624 WP_003097711.1.92642 WP_003097711.1.92769 WP_003097711.1.92894 WP_003097711.1.92924 WP_003097711.1.93001 WP_003097711.1.93144 WP_003097711.1.9328 WP_003097711.1.93547 WP_003097711.1.93562 WP_003097711.1.94004 WP_003097711.1.94031 WP_003097711.1.94136 WP_003097711.1.94211 WP_003097711.1.94385 WP_003097711.1.94682 WP_003097711.1.94814 WP_003097711.1.94818 WP_003097711.1.94856 WP_003097711.1.95027 WP_003097711.1.95117 WP_003097711.1.95187 WP_003097711.1.95359 WP_003097711.1.95460 WP_003097711.1.95525 WP_003097711.1.95536 WP_003097711.1.95638 WP_003097711.1.95668 WP_003097711.1.95802 WP_003097711.1.95820 WP_003097711.1.95825 WP_003097711.1.9599 WP_003097711.1.96041 WP_003097711.1.96243 WP_003097711.1.96267 WP_003097711.1.96384 WP_003097711.1.96452 WP_003097711.1.96714 WP_003097711.1.9706 WP_003097711.1.97118 WP_003097711.1.97213 WP_003097711.1.9722 WP_003097711.1.97474 WP_003097711.1.97614 WP_003097711.1.977 WP_003097711.1.97826 WP_003097711.1.97877 WP_003097711.1.97968 WP_003097711.1.98276 WP_003097711.1.98410 WP_003097711.1.98414 WP_003097711.1.98515 WP_003097711.1.98610 WP_003097711.1.9885 WP_003097711.1.98926 WP_003097711.1.99068 WP_003097711.1.99389 WP_003097711.1.99461 WP_003097711.1.99516 WP_003097711.1.99654 WP_003097711.1.99757 WP_003097711.1.99795 WP_003097711.1.9989 gi|218891174|ref|YP_002440040.1| 557722.PLES_24401 gi|568153588|ref|YP_008942558.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]