SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153644|ref|YP_008942614.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153644|ref|YP_008942614.1|
Domain Number 1 Region: 172-314
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.61e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 35-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000141
Family Glutathione S-transferase (GST), N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568153644|ref|YP_008942614.1|
Sequence length 324
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MGQLIDGRWHDQWYDTQKDGRFQRENAQRRHWLGEPAFPAEGGRYHLYVSLACPWAHRTL
VVRKLKGLESLVDVSVVSWLMRENGWTFDPAHGSTGDRLDGLAFLHQRYTRDDPHYSGRV
TVPLLWDKQAQKIVNNESADIVRIFNSAFDAIGANALDFYPEPLREEIERLNGRIYPAVN
NGVYRAGFATRQDAYEEAFVQLFEELDYLEGLLGERRYLAGEYLTEADIRLFTTLVRFDA
VYHGHFKCNLRRIEDYPNLSGWLRELYQRPGIGETVDFEHIKGHYYASHRTINPTGIVPL
GPRLDLARAPGRERLPGKGIWGEG
Download sequence
Identical sequences 557722.PLES_24951 gi|218891229|ref|YP_002440095.1| WP_012613992.1.11026 WP_012613992.1.11943 WP_012613992.1.13232 WP_012613992.1.14714 WP_012613992.1.1475 WP_012613992.1.21517 WP_012613992.1.22863 WP_012613992.1.23195 WP_012613992.1.23715 WP_012613992.1.24351 WP_012613992.1.251 WP_012613992.1.25142 WP_012613992.1.27837 WP_012613992.1.31279 WP_012613992.1.32544 WP_012613992.1.33210 WP_012613992.1.34832 WP_012613992.1.35857 WP_012613992.1.3833 WP_012613992.1.38502 WP_012613992.1.39088 WP_012613992.1.43662 WP_012613992.1.45090 WP_012613992.1.45485 WP_012613992.1.45934 WP_012613992.1.46152 WP_012613992.1.47774 WP_012613992.1.52690 WP_012613992.1.56797 WP_012613992.1.59076 WP_012613992.1.60415 WP_012613992.1.61696 WP_012613992.1.62516 WP_012613992.1.62534 WP_012613992.1.62701 WP_012613992.1.65099 WP_012613992.1.66526 WP_012613992.1.67388 WP_012613992.1.67686 WP_012613992.1.68862 WP_012613992.1.72331 WP_012613992.1.73149 WP_012613992.1.7547 WP_012613992.1.78430 WP_012613992.1.84374 WP_012613992.1.86545 WP_012613992.1.87435 WP_012613992.1.91431 WP_012613992.1.92624 WP_012613992.1.92769 WP_012613992.1.9722 WP_012613992.1.99461 WP_012613992.1.99757 gi|568153644|ref|YP_008942614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]