SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153681|ref|YP_008942655.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568153681|ref|YP_008942655.1|
Domain Number - Region: 4-80
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0301
Family Cation efflux protein transmembrane domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568153681|ref|YP_008942655.1|
Sequence length 94
Comment hypothetical protein T223_12940 [Pseudomonas aeruginosa LES431]
Sequence
MVDPWTLVAAMICGAICMRLATYRRQGARYRRGVSWLAYLLCVGSGCFALSVMLDALHGY
RLNPVSPWLTLVLAILLGLVCRARGNLAHILRVY
Download sequence
Identical sequences A0A077STS9 A0A0H3QY29 A0A0U4J8T9 H2BDJ4
557722.PLES_25321 WP_003101053.1.100276 WP_003101053.1.100394 WP_003101053.1.100469 WP_003101053.1.100473 WP_003101053.1.100809 WP_003101053.1.101642 WP_003101053.1.101712 WP_003101053.1.11163 WP_003101053.1.11178 WP_003101053.1.11854 WP_003101053.1.1187 WP_003101053.1.12400 WP_003101053.1.12497 WP_003101053.1.12657 WP_003101053.1.12891 WP_003101053.1.12930 WP_003101053.1.13092 WP_003101053.1.1333 WP_003101053.1.13865 WP_003101053.1.14096 WP_003101053.1.14378 WP_003101053.1.14640 WP_003101053.1.14754 WP_003101053.1.15130 WP_003101053.1.15231 WP_003101053.1.15297 WP_003101053.1.15886 WP_003101053.1.16239 WP_003101053.1.16419 WP_003101053.1.17155 WP_003101053.1.1758 WP_003101053.1.18054 WP_003101053.1.18199 WP_003101053.1.19251 WP_003101053.1.19260 WP_003101053.1.19269 WP_003101053.1.20216 WP_003101053.1.20607 WP_003101053.1.20825 WP_003101053.1.20929 WP_003101053.1.21460 WP_003101053.1.21871 WP_003101053.1.21891 WP_003101053.1.2237 WP_003101053.1.22442 WP_003101053.1.22477 WP_003101053.1.22573 WP_003101053.1.23013 WP_003101053.1.23418 WP_003101053.1.23925 WP_003101053.1.24087 WP_003101053.1.2453 WP_003101053.1.24626 WP_003101053.1.24938 WP_003101053.1.24940 WP_003101053.1.25033 WP_003101053.1.2529 WP_003101053.1.2535 WP_003101053.1.25600 WP_003101053.1.26301 WP_003101053.1.2652 WP_003101053.1.26816 WP_003101053.1.26906 WP_003101053.1.27218 WP_003101053.1.27259 WP_003101053.1.27939 WP_003101053.1.29003 WP_003101053.1.29127 WP_003101053.1.29137 WP_003101053.1.29440 WP_003101053.1.29472 WP_003101053.1.29650 WP_003101053.1.29920 WP_003101053.1.30000 WP_003101053.1.3030 WP_003101053.1.30475 WP_003101053.1.30815 WP_003101053.1.31045 WP_003101053.1.31565 WP_003101053.1.31732 WP_003101053.1.31741 WP_003101053.1.31939 WP_003101053.1.32544 WP_003101053.1.32596 WP_003101053.1.32821 WP_003101053.1.33294 WP_003101053.1.33653 WP_003101053.1.33733 WP_003101053.1.34136 WP_003101053.1.34203 WP_003101053.1.34625 WP_003101053.1.34784 WP_003101053.1.34821 WP_003101053.1.34832 WP_003101053.1.34836 WP_003101053.1.34878 WP_003101053.1.34922 WP_003101053.1.35149 WP_003101053.1.35325 WP_003101053.1.35762 WP_003101053.1.35984 WP_003101053.1.37500 WP_003101053.1.38102 WP_003101053.1.38510 WP_003101053.1.38816 WP_003101053.1.38834 WP_003101053.1.39046 WP_003101053.1.39765 WP_003101053.1.3998 WP_003101053.1.40135 WP_003101053.1.40237 WP_003101053.1.40541 WP_003101053.1.40595 WP_003101053.1.41487 WP_003101053.1.41618 WP_003101053.1.41703 WP_003101053.1.42294 WP_003101053.1.42508 WP_003101053.1.42854 WP_003101053.1.42972 WP_003101053.1.43356 WP_003101053.1.43593 WP_003101053.1.43667 WP_003101053.1.43673 WP_003101053.1.43811 WP_003101053.1.44213 WP_003101053.1.44552 WP_003101053.1.44959 WP_003101053.1.45298 WP_003101053.1.45358 WP_003101053.1.45818 WP_003101053.1.45961 WP_003101053.1.46826 WP_003101053.1.47158 WP_003101053.1.47314 WP_003101053.1.47930 WP_003101053.1.48094 WP_003101053.1.48141 WP_003101053.1.48178 WP_003101053.1.48382 WP_003101053.1.48546 WP_003101053.1.49293 WP_003101053.1.50222 WP_003101053.1.52244 WP_003101053.1.52334 WP_003101053.1.52355 WP_003101053.1.52403 WP_003101053.1.53427 WP_003101053.1.53663 WP_003101053.1.53719 WP_003101053.1.53951 WP_003101053.1.54140 WP_003101053.1.54146 WP_003101053.1.55400 WP_003101053.1.55976 WP_003101053.1.56188 WP_003101053.1.56196 WP_003101053.1.56837 WP_003101053.1.57839 WP_003101053.1.57841 WP_003101053.1.57966 WP_003101053.1.58162 WP_003101053.1.58294 WP_003101053.1.58417 WP_003101053.1.5850 WP_003101053.1.58689 WP_003101053.1.59246 WP_003101053.1.59339 WP_003101053.1.594 WP_003101053.1.59724 WP_003101053.1.59943 WP_003101053.1.60206 WP_003101053.1.60396 WP_003101053.1.60686 WP_003101053.1.60850 WP_003101053.1.60979 WP_003101053.1.61294 WP_003101053.1.61299 WP_003101053.1.61431 WP_003101053.1.6280 WP_003101053.1.63659 WP_003101053.1.64433 WP_003101053.1.65197 WP_003101053.1.65227 WP_003101053.1.65247 WP_003101053.1.65334 WP_003101053.1.65867 WP_003101053.1.66345 WP_003101053.1.67545 WP_003101053.1.6768 WP_003101053.1.68446 WP_003101053.1.68448 WP_003101053.1.68568 WP_003101053.1.68800 WP_003101053.1.68881 WP_003101053.1.69599 WP_003101053.1.69819 WP_003101053.1.70098 WP_003101053.1.71570 WP_003101053.1.71642 WP_003101053.1.71738 WP_003101053.1.71866 WP_003101053.1.71934 WP_003101053.1.72183 WP_003101053.1.72323 WP_003101053.1.72653 WP_003101053.1.72669 WP_003101053.1.73035 WP_003101053.1.73149 WP_003101053.1.73172 WP_003101053.1.73941 WP_003101053.1.74106 WP_003101053.1.74175 WP_003101053.1.74475 WP_003101053.1.7448 WP_003101053.1.7456 WP_003101053.1.74941 WP_003101053.1.75389 WP_003101053.1.75825 WP_003101053.1.76077 WP_003101053.1.76383 WP_003101053.1.76441 WP_003101053.1.77442 WP_003101053.1.7779 WP_003101053.1.78134 WP_003101053.1.78926 WP_003101053.1.79060 WP_003101053.1.79256 WP_003101053.1.79699 WP_003101053.1.79862 WP_003101053.1.79908 WP_003101053.1.80033 WP_003101053.1.8013 WP_003101053.1.8028 WP_003101053.1.80880 WP_003101053.1.80926 WP_003101053.1.81368 WP_003101053.1.81482 WP_003101053.1.81591 WP_003101053.1.81784 WP_003101053.1.81874 WP_003101053.1.81957 WP_003101053.1.8227 WP_003101053.1.82810 WP_003101053.1.8351 WP_003101053.1.83698 WP_003101053.1.83871 WP_003101053.1.84439 WP_003101053.1.84792 WP_003101053.1.84937 WP_003101053.1.85298 WP_003101053.1.85453 WP_003101053.1.85920 WP_003101053.1.86182 WP_003101053.1.86386 WP_003101053.1.86660 WP_003101053.1.86785 WP_003101053.1.87183 WP_003101053.1.87463 WP_003101053.1.8749 WP_003101053.1.87970 WP_003101053.1.87975 WP_003101053.1.88605 WP_003101053.1.88679 WP_003101053.1.88750 WP_003101053.1.88969 WP_003101053.1.89434 WP_003101053.1.89669 WP_003101053.1.90024 WP_003101053.1.90110 WP_003101053.1.90940 WP_003101053.1.91527 WP_003101053.1.91563 WP_003101053.1.92321 WP_003101053.1.92839 WP_003101053.1.92924 WP_003101053.1.92930 WP_003101053.1.93250 WP_003101053.1.9349 WP_003101053.1.93493 WP_003101053.1.94230 WP_003101053.1.95359 WP_003101053.1.97272 WP_003101053.1.97877 WP_003101053.1.98111 WP_003101053.1.98814 WP_003101053.1.99068 WP_003101053.1.99103 WP_003101053.1.99654 WP_003101053.1.99835 WP_003101053.1.99930 YP_005098293.1.10302 gi|218891265|ref|YP_002440132.1| gi|568153681|ref|YP_008942655.1| gi|374531735|ref|YP_005098293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]