SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153773|ref|YP_008942750.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153773|ref|YP_008942750.1|
Domain Number 1 Region: 25-221
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 7.85e-56
Family Cation efflux protein transmembrane domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 224-298
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.00000301
Family Cation efflux protein cytoplasmic domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568153773|ref|YP_008942750.1|
Sequence length 340
Comment zinc transporter ZitB [Pseudomonas aeruginosa LES431]
Sequence
MSQSNAHDHGHDHDHDHTPTVTSANERKVLVSFFLIFGFMLVEAVGGVLSGSLALLADAG
HMLTDAVALALAYAAFRFGRRAADSKRTFGYLRFEVIAGFLNAVTLFAIVAWIAYEAWER
LQAPPVILAGPMMIVAVLGLLINVLVLWIMTRGETDHVNVKGAILHVMGDLLGSVGAIVA
AIVIYFTGWTPIDPILSVLVAALILRSAWKLLAKSIHILLEGAPEDASPEKVEQGLMSTV
PGLAAVSHVHVWQLTSGRTMATLHVRPNVDEEARAVVKRVEAVLREQFSIEHATVGIDWN
SEADENICSLQPTTGRQDHSGHDHSEHNHDHDHSAPGHKH
Download sequence
Identical sequences A0A1A8TKM0 A0A2E5TE55 A0A2E7JD38 A0A2G2MPE7 A0A2J9Q933 B9MG30
gi|568153773|ref|YP_008942750.1| gi|222110357|ref|YP_002552621.1| 535289.Dtpsy_1148 WP_003821153.1.100071 WP_003821153.1.100420 WP_003821153.1.100700 WP_003821153.1.100810 WP_003821153.1.100995 WP_003821153.1.102045 WP_003821153.1.10572 WP_003821153.1.10641 WP_003821153.1.11026 WP_003821153.1.11077 WP_003821153.1.11744 WP_003821153.1.11847 WP_003821153.1.11943 WP_003821153.1.12482 WP_003821153.1.12873 WP_003821153.1.12970 WP_003821153.1.13 WP_003821153.1.1305 WP_003821153.1.13232 WP_003821153.1.1356 WP_003821153.1.1362 WP_003821153.1.13765 WP_003821153.1.14714 WP_003821153.1.1475 WP_003821153.1.14820 WP_003821153.1.15474 WP_003821153.1.15485 WP_003821153.1.16059 WP_003821153.1.16109 WP_003821153.1.16279 WP_003821153.1.16419 WP_003821153.1.1671 WP_003821153.1.17566 WP_003821153.1.17883 WP_003821153.1.190 WP_003821153.1.19771 WP_003821153.1.20744 WP_003821153.1.20764 WP_003821153.1.20884 WP_003821153.1.209 WP_003821153.1.21242 WP_003821153.1.2141 WP_003821153.1.21448 WP_003821153.1.21517 WP_003821153.1.2172 WP_003821153.1.21932 WP_003821153.1.22863 WP_003821153.1.22891 WP_003821153.1.23195 WP_003821153.1.23418 WP_003821153.1.23641 WP_003821153.1.23715 WP_003821153.1.23961 WP_003821153.1.24351 WP_003821153.1.251 WP_003821153.1.25142 WP_003821153.1.25149 WP_003821153.1.25348 WP_003821153.1.25532 WP_003821153.1.261 WP_003821153.1.26539 WP_003821153.1.26954 WP_003821153.1.27018 WP_003821153.1.27534 WP_003821153.1.27738 WP_003821153.1.27837 WP_003821153.1.28006 WP_003821153.1.28465 WP_003821153.1.28468 WP_003821153.1.28849 WP_003821153.1.29208 WP_003821153.1.29472 WP_003821153.1.30567 WP_003821153.1.30707 WP_003821153.1.30886 WP_003821153.1.31087 WP_003821153.1.31105 WP_003821153.1.31138 WP_003821153.1.31279 WP_003821153.1.32544 WP_003821153.1.33133 WP_003821153.1.33152 WP_003821153.1.33210 WP_003821153.1.33216 WP_003821153.1.33658 WP_003821153.1.34000 WP_003821153.1.34832 WP_003821153.1.35682 WP_003821153.1.35768 WP_003821153.1.35857 WP_003821153.1.35872 WP_003821153.1.36170 WP_003821153.1.36587 WP_003821153.1.37163 WP_003821153.1.37208 WP_003821153.1.3721 WP_003821153.1.37814 WP_003821153.1.37842 WP_003821153.1.3792 WP_003821153.1.38146 WP_003821153.1.38151 WP_003821153.1.38319 WP_003821153.1.3833 WP_003821153.1.38502 WP_003821153.1.38583 WP_003821153.1.38661 WP_003821153.1.38889 WP_003821153.1.39088 WP_003821153.1.39186 WP_003821153.1.39271 WP_003821153.1.39444 WP_003821153.1.39786 WP_003821153.1.3998 WP_003821153.1.39989 WP_003821153.1.40243 WP_003821153.1.40512 WP_003821153.1.41301 WP_003821153.1.41732 WP_003821153.1.41832 WP_003821153.1.42146 WP_003821153.1.42757 WP_003821153.1.42854 WP_003821153.1.43400 WP_003821153.1.43662 WP_003821153.1.44260 WP_003821153.1.44581 WP_003821153.1.45090 WP_003821153.1.45464 WP_003821153.1.45485 WP_003821153.1.45934 WP_003821153.1.46093 WP_003821153.1.46152 WP_003821153.1.46755 WP_003821153.1.46926 WP_003821153.1.47101 WP_003821153.1.47774 WP_003821153.1.47842 WP_003821153.1.48001 WP_003821153.1.48086 WP_003821153.1.48842 WP_003821153.1.49265 WP_003821153.1.49266 WP_003821153.1.49688 WP_003821153.1.49798 WP_003821153.1.51019 WP_003821153.1.51807 WP_003821153.1.52220 WP_003821153.1.52537 WP_003821153.1.5258 WP_003821153.1.52583 WP_003821153.1.52690 WP_003821153.1.52700 WP_003821153.1.52784 WP_003821153.1.53932 WP_003821153.1.54003 WP_003821153.1.54657 WP_003821153.1.54809 WP_003821153.1.55169 WP_003821153.1.56128 WP_003821153.1.56315 WP_003821153.1.56797 WP_003821153.1.56973 WP_003821153.1.57276 WP_003821153.1.58193 WP_003821153.1.59076 WP_003821153.1.59246 WP_003821153.1.60415 WP_003821153.1.60602 WP_003821153.1.60916 WP_003821153.1.61130 WP_003821153.1.61209 WP_003821153.1.6130 WP_003821153.1.61598 WP_003821153.1.61619 WP_003821153.1.61696 WP_003821153.1.62483 WP_003821153.1.62516 WP_003821153.1.62534 WP_003821153.1.62701 WP_003821153.1.62768 WP_003821153.1.62873 WP_003821153.1.62985 WP_003821153.1.63136 WP_003821153.1.63597 WP_003821153.1.63929 WP_003821153.1.64807 WP_003821153.1.64862 WP_003821153.1.64984 WP_003821153.1.65099 WP_003821153.1.65145 WP_003821153.1.65642 WP_003821153.1.65819 WP_003821153.1.65926 WP_003821153.1.66526 WP_003821153.1.66929 WP_003821153.1.66950 WP_003821153.1.67205 WP_003821153.1.67261 WP_003821153.1.67370 WP_003821153.1.67388 WP_003821153.1.67472 WP_003821153.1.67526 WP_003821153.1.67686 WP_003821153.1.67830 WP_003821153.1.67874 WP_003821153.1.68252 WP_003821153.1.68756 WP_003821153.1.68850 WP_003821153.1.68862 WP_003821153.1.68938 WP_003821153.1.69159 WP_003821153.1.69260 WP_003821153.1.69702 WP_003821153.1.69993 WP_003821153.1.7077 WP_003821153.1.70778 WP_003821153.1.71038 WP_003821153.1.7128 WP_003821153.1.71962 WP_003821153.1.72167 WP_003821153.1.72287 WP_003821153.1.72331 WP_003821153.1.72768 WP_003821153.1.73048 WP_003821153.1.73149 WP_003821153.1.7327 WP_003821153.1.74219 WP_003821153.1.74458 WP_003821153.1.74473 WP_003821153.1.74568 WP_003821153.1.7547 WP_003821153.1.75549 WP_003821153.1.75573 WP_003821153.1.7595 WP_003821153.1.76600 WP_003821153.1.76716 WP_003821153.1.77317 WP_003821153.1.77769 WP_003821153.1.78430 WP_003821153.1.78570 WP_003821153.1.79311 WP_003821153.1.7953 WP_003821153.1.79569 WP_003821153.1.80410 WP_003821153.1.8064 WP_003821153.1.81844 WP_003821153.1.81950 WP_003821153.1.83184 WP_003821153.1.83251 WP_003821153.1.83296 WP_003821153.1.83394 WP_003821153.1.835 WP_003821153.1.84190 WP_003821153.1.84374 WP_003821153.1.8453 WP_003821153.1.84674 WP_003821153.1.85096 WP_003821153.1.85318 WP_003821153.1.85897 WP_003821153.1.86278 WP_003821153.1.86545 WP_003821153.1.86552 WP_003821153.1.86947 WP_003821153.1.87435 WP_003821153.1.88714 WP_003821153.1.89577 WP_003821153.1.89662 WP_003821153.1.89736 WP_003821153.1.89805 WP_003821153.1.89866 WP_003821153.1.90242 WP_003821153.1.90306 WP_003821153.1.90412 WP_003821153.1.90569 WP_003821153.1.9120 WP_003821153.1.9143 WP_003821153.1.91431 WP_003821153.1.92573 WP_003821153.1.92624 WP_003821153.1.92769 WP_003821153.1.92894 WP_003821153.1.9328 WP_003821153.1.94004 WP_003821153.1.94682 WP_003821153.1.95027 WP_003821153.1.95117 WP_003821153.1.95187 WP_003821153.1.95460 WP_003821153.1.95525 WP_003821153.1.95820 WP_003821153.1.95825 WP_003821153.1.9599 WP_003821153.1.96243 WP_003821153.1.96267 WP_003821153.1.97118 WP_003821153.1.9722 WP_003821153.1.97474 WP_003821153.1.97614 WP_003821153.1.97968 WP_003821153.1.98410 WP_003821153.1.98414 WP_003821153.1.98610 WP_003821153.1.99461 WP_003821153.1.99590 WP_003821153.1.99757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]