SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153934|ref|YP_008942912.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153934|ref|YP_008942912.1|
Domain Number 1 Region: 204-333
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-35
Family Aromatic dioxygenase reductase-like 0.0000582
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00031
Further Details:      
 
Domain Number 3 Region: 76-204
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.77e-23
Family Ferredoxin reductase FAD-binding domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568153934|ref|YP_008942912.1|
Sequence length 337
Comment NADH oxidase [Pseudomonas aeruginosa LES431]
Sequence
MNHRIALNFEDGVTRFIHAAPGETVADAAYRQGINIPLDCRDGACGTCKCLAEAGRYALG
QDYIDDALSAEEAARGYVLTCQMRAESDCVLRVPASSTLCRTGQARYEARISEVRQLSPS
TIGLSLRGEALASLAFLPGQYVNLQVPGSEQRRAYSFSSLAKDGEVSFLIRNVPGGLMSG
FLSGTARAGDSLAMDGPLGSFYLREIHRPLLMLAGGTGLAPFTAMLERIAEQGSAHPLHL
VYGVTHDVDLVGLERLEAFAERIPGFTWSACVASADSDYPRKGYVTEHIAAQHLHEGDVD
IYLCGPPPMVEAVERYLREQGVRPANFYYEKFAASAA
Download sequence
Identical sequences A0A073A1A9 A0A0E1ASL2 A0A0H2ZBS9 A0A0H3R152 A0A157WRC2 A0A1E9D439 A0A1F0J3H1 A0A1G5LZ92 A0A1S1C9N3 Q9I0W6
gi|392983929|ref|YP_006482516.1| 208963.PA14_32110 208964.PA2516 557722.PLES_27791 gi|15597712|ref|NP_251206.1| NP_251206.1.87394 WP_003109537.1.100071 WP_003109537.1.100100 WP_003109537.1.100179 WP_003109537.1.100276 WP_003109537.1.100278 WP_003109537.1.100394 WP_003109537.1.100420 WP_003109537.1.100456 WP_003109537.1.100473 WP_003109537.1.100476 WP_003109537.1.100523 WP_003109537.1.100654 WP_003109537.1.100723 WP_003109537.1.100777 WP_003109537.1.100786 WP_003109537.1.100809 WP_003109537.1.100810 WP_003109537.1.100995 WP_003109537.1.101021 WP_003109537.1.101269 WP_003109537.1.101506 WP_003109537.1.101572 WP_003109537.1.101642 WP_003109537.1.101712 WP_003109537.1.101739 WP_003109537.1.10179 WP_003109537.1.101809 WP_003109537.1.101863 WP_003109537.1.101871 WP_003109537.1.102045 WP_003109537.1.10248 WP_003109537.1.10257 WP_003109537.1.1037 WP_003109537.1.10407 WP_003109537.1.10419 WP_003109537.1.10457 WP_003109537.1.10468 WP_003109537.1.10477 WP_003109537.1.10482 WP_003109537.1.10513 WP_003109537.1.10529 WP_003109537.1.10548 WP_003109537.1.10572 WP_003109537.1.10575 WP_003109537.1.10641 WP_003109537.1.10684 WP_003109537.1.10764 WP_003109537.1.10856 WP_003109537.1.10895 WP_003109537.1.10901 WP_003109537.1.10949 WP_003109537.1.11026 WP_003109537.1.11058 WP_003109537.1.1107 WP_003109537.1.11077 WP_003109537.1.1109 WP_003109537.1.11163 WP_003109537.1.11178 WP_003109537.1.11318 WP_003109537.1.11388 WP_003109537.1.11410 WP_003109537.1.11417 WP_003109537.1.11454 WP_003109537.1.11568 WP_003109537.1.11569 WP_003109537.1.11653 WP_003109537.1.11744 WP_003109537.1.1180 WP_003109537.1.11847 WP_003109537.1.1187 WP_003109537.1.11943 WP_003109537.1.12081 WP_003109537.1.12120 WP_003109537.1.12150 WP_003109537.1.12200 WP_003109537.1.12208 WP_003109537.1.12240 WP_003109537.1.12482 WP_003109537.1.12530 WP_003109537.1.12547 WP_003109537.1.12561 WP_003109537.1.12657 WP_003109537.1.12670 WP_003109537.1.12687 WP_003109537.1.12744 WP_003109537.1.12797 WP_003109537.1.12838 WP_003109537.1.12873 WP_003109537.1.12891 WP_003109537.1.12922 WP_003109537.1.12930 WP_003109537.1.12934 WP_003109537.1.12970 WP_003109537.1.13 WP_003109537.1.13041 WP_003109537.1.1305 WP_003109537.1.13057 WP_003109537.1.13085 WP_003109537.1.13208 WP_003109537.1.13232 WP_003109537.1.13242 WP_003109537.1.13266 WP_003109537.1.13315 WP_003109537.1.1333 WP_003109537.1.13407 WP_003109537.1.13529 WP_003109537.1.13533 WP_003109537.1.1356 WP_003109537.1.1362 WP_003109537.1.13622 WP_003109537.1.13718 WP_003109537.1.13743 WP_003109537.1.13758 WP_003109537.1.13785 WP_003109537.1.13795 WP_003109537.1.13828 WP_003109537.1.13865 WP_003109537.1.1393 WP_003109537.1.14049 WP_003109537.1.14078 WP_003109537.1.14096 WP_003109537.1.14204 WP_003109537.1.14251 WP_003109537.1.14378 WP_003109537.1.14424 WP_003109537.1.14460 WP_003109537.1.14463 WP_003109537.1.14525 WP_003109537.1.14564 WP_003109537.1.14615 WP_003109537.1.14714 WP_003109537.1.1475 WP_003109537.1.14754 WP_003109537.1.14815 WP_003109537.1.14820 WP_003109537.1.14835 WP_003109537.1.14839 WP_003109537.1.14883 WP_003109537.1.14966 WP_003109537.1.1516 WP_003109537.1.152 WP_003109537.1.15222 WP_003109537.1.15231 WP_003109537.1.15281 WP_003109537.1.15297 WP_003109537.1.15328 WP_003109537.1.15373 WP_003109537.1.15379 WP_003109537.1.15474 WP_003109537.1.15482 WP_003109537.1.15485 WP_003109537.1.15602 WP_003109537.1.15606 WP_003109537.1.15886 WP_003109537.1.15889 WP_003109537.1.16074 WP_003109537.1.16109 WP_003109537.1.16142 WP_003109537.1.16161 WP_003109537.1.16197 WP_003109537.1.162 WP_003109537.1.16239 WP_003109537.1.16267 WP_003109537.1.16419 WP_003109537.1.16660 WP_003109537.1.16694 WP_003109537.1.1671 WP_003109537.1.16751 WP_003109537.1.16808 WP_003109537.1.16811 WP_003109537.1.16895 WP_003109537.1.17022 WP_003109537.1.1704 WP_003109537.1.17108 WP_003109537.1.17155 WP_003109537.1.17177 WP_003109537.1.17223 WP_003109537.1.17353 WP_003109537.1.17354 WP_003109537.1.17370 WP_003109537.1.1739 WP_003109537.1.17397 WP_003109537.1.17566 WP_003109537.1.1758 WP_003109537.1.1761 WP_003109537.1.17697 WP_003109537.1.17883 WP_003109537.1.17890 WP_003109537.1.18052 WP_003109537.1.18054 WP_003109537.1.18117 WP_003109537.1.18156 WP_003109537.1.18157 WP_003109537.1.18204 WP_003109537.1.18234 WP_003109537.1.1824 WP_003109537.1.18440 WP_003109537.1.18493 WP_003109537.1.18508 WP_003109537.1.18547 WP_003109537.1.18653 WP_003109537.1.18728 WP_003109537.1.18735 WP_003109537.1.18769 WP_003109537.1.18892 WP_003109537.1.18907 WP_003109537.1.18911 WP_003109537.1.18930 WP_003109537.1.190 WP_003109537.1.19089 WP_003109537.1.19199 WP_003109537.1.19251 WP_003109537.1.19260 WP_003109537.1.19269 WP_003109537.1.19351 WP_003109537.1.1938 WP_003109537.1.19552 WP_003109537.1.19640 WP_003109537.1.19703 WP_003109537.1.1971 WP_003109537.1.19718 WP_003109537.1.19741 WP_003109537.1.19771 WP_003109537.1.19803 WP_003109537.1.19824 WP_003109537.1.19930 WP_003109537.1.19931 WP_003109537.1.20070 WP_003109537.1.2012 WP_003109537.1.20125 WP_003109537.1.20134 WP_003109537.1.20154 WP_003109537.1.20216 WP_003109537.1.20682 WP_003109537.1.20692 WP_003109537.1.20744 WP_003109537.1.20764 WP_003109537.1.20825 WP_003109537.1.20854 WP_003109537.1.20880 WP_003109537.1.20884 WP_003109537.1.20890 WP_003109537.1.209 WP_003109537.1.20978 WP_003109537.1.21096 WP_003109537.1.21100 WP_003109537.1.21166 WP_003109537.1.21209 WP_003109537.1.21242 WP_003109537.1.21349 WP_003109537.1.21358 WP_003109537.1.2144 WP_003109537.1.21448 WP_003109537.1.21460 WP_003109537.1.21469 WP_003109537.1.21471 WP_003109537.1.21517 WP_003109537.1.21607 WP_003109537.1.21718 WP_003109537.1.2172 WP_003109537.1.21744 WP_003109537.1.21782 WP_003109537.1.21871 WP_003109537.1.21891 WP_003109537.1.21932 WP_003109537.1.22078 WP_003109537.1.221 WP_003109537.1.2228 WP_003109537.1.22316 WP_003109537.1.22324 WP_003109537.1.22365 WP_003109537.1.22390 WP_003109537.1.22394 WP_003109537.1.22442 WP_003109537.1.22477 WP_003109537.1.22491 WP_003109537.1.22573 WP_003109537.1.22671 WP_003109537.1.22704 WP_003109537.1.22729 WP_003109537.1.22863 WP_003109537.1.2289 WP_003109537.1.22891 WP_003109537.1.23013 WP_003109537.1.23166 WP_003109537.1.23191 WP_003109537.1.23195 WP_003109537.1.2323 WP_003109537.1.23264 WP_003109537.1.23331 WP_003109537.1.23418 WP_003109537.1.23421 WP_003109537.1.23512 WP_003109537.1.23523 WP_003109537.1.2355 WP_003109537.1.23559 WP_003109537.1.23581 WP_003109537.1.236 WP_003109537.1.23611 WP_003109537.1.23641 WP_003109537.1.23715 WP_003109537.1.23739 WP_003109537.1.23769 WP_003109537.1.23782 WP_003109537.1.23884 WP_003109537.1.23925 WP_003109537.1.23961 WP_003109537.1.23983 WP_003109537.1.24066 WP_003109537.1.24077 WP_003109537.1.24087 WP_003109537.1.24183 WP_003109537.1.24234 WP_003109537.1.24319 WP_003109537.1.24351 WP_003109537.1.24413 WP_003109537.1.24447 WP_003109537.1.2453 WP_003109537.1.24626 WP_003109537.1.24662 WP_003109537.1.2477 WP_003109537.1.24851 WP_003109537.1.24869 WP_003109537.1.24879 WP_003109537.1.24938 WP_003109537.1.24940 WP_003109537.1.25052 WP_003109537.1.25067 WP_003109537.1.25075 WP_003109537.1.251 WP_003109537.1.25109 WP_003109537.1.2511 WP_003109537.1.25142 WP_003109537.1.25149 WP_003109537.1.25179 WP_003109537.1.25191 WP_003109537.1.25271 WP_003109537.1.2529 WP_003109537.1.2530 WP_003109537.1.25328 WP_003109537.1.25344 WP_003109537.1.25348 WP_003109537.1.2535 WP_003109537.1.25477 WP_003109537.1.25532 WP_003109537.1.25600 WP_003109537.1.25675 WP_003109537.1.25834 WP_003109537.1.25903 WP_003109537.1.2596 WP_003109537.1.25964 WP_003109537.1.26010 WP_003109537.1.26025 WP_003109537.1.26042 WP_003109537.1.261 WP_003109537.1.26159 WP_003109537.1.26334 WP_003109537.1.26463 WP_003109537.1.26473 WP_003109537.1.26489 WP_003109537.1.2652 WP_003109537.1.26539 WP_003109537.1.26553 WP_003109537.1.26604 WP_003109537.1.26681 WP_003109537.1.26705 WP_003109537.1.26740 WP_003109537.1.26816 WP_003109537.1.26841 WP_003109537.1.26906 WP_003109537.1.2698 WP_003109537.1.27018 WP_003109537.1.27028 WP_003109537.1.27039 WP_003109537.1.27107 WP_003109537.1.27211 WP_003109537.1.27218 WP_003109537.1.27259 WP_003109537.1.27505 WP_003109537.1.27534 WP_003109537.1.27575 WP_003109537.1.27587 WP_003109537.1.27687 WP_003109537.1.27738 WP_003109537.1.27772 WP_003109537.1.27783 WP_003109537.1.27837 WP_003109537.1.27858 WP_003109537.1.27933 WP_003109537.1.28006 WP_003109537.1.28057 WP_003109537.1.28064 WP_003109537.1.28078 WP_003109537.1.28136 WP_003109537.1.28175 WP_003109537.1.28193 WP_003109537.1.283 WP_003109537.1.28316 WP_003109537.1.28329 WP_003109537.1.28383 WP_003109537.1.28404 WP_003109537.1.28468 WP_003109537.1.28505 WP_003109537.1.28560 WP_003109537.1.28623 WP_003109537.1.28699 WP_003109537.1.28713 WP_003109537.1.28757 WP_003109537.1.28800 WP_003109537.1.28823 WP_003109537.1.28849 WP_003109537.1.29062 WP_003109537.1.29137 WP_003109537.1.29179 WP_003109537.1.29208 WP_003109537.1.2927 WP_003109537.1.29401 WP_003109537.1.2941 WP_003109537.1.29438 WP_003109537.1.29440 WP_003109537.1.29472 WP_003109537.1.2948 WP_003109537.1.29481 WP_003109537.1.29498 WP_003109537.1.29501 WP_003109537.1.29577 WP_003109537.1.2961 WP_003109537.1.29633 WP_003109537.1.29668 WP_003109537.1.29753 WP_003109537.1.29767 WP_003109537.1.29848 WP_003109537.1.29920 WP_003109537.1.29958 WP_003109537.1.29973 WP_003109537.1.30081 WP_003109537.1.30120 WP_003109537.1.30254 WP_003109537.1.30365 WP_003109537.1.30475 WP_003109537.1.30563 WP_003109537.1.30567 WP_003109537.1.30614 WP_003109537.1.30615 WP_003109537.1.30625 WP_003109537.1.30693 WP_003109537.1.30707 WP_003109537.1.3072 WP_003109537.1.30740 WP_003109537.1.30797 WP_003109537.1.30815 WP_003109537.1.30886 WP_003109537.1.30943 WP_003109537.1.30973 WP_003109537.1.30994 WP_003109537.1.31076 WP_003109537.1.31087 WP_003109537.1.31103 WP_003109537.1.31105 WP_003109537.1.31138 WP_003109537.1.31147 WP_003109537.1.31279 WP_003109537.1.31361 WP_003109537.1.31457 WP_003109537.1.31501 WP_003109537.1.31563 WP_003109537.1.31655 WP_003109537.1.3172 WP_003109537.1.31732 WP_003109537.1.31741 WP_003109537.1.31848 WP_003109537.1.31852 WP_003109537.1.319 WP_003109537.1.32134 WP_003109537.1.32137 WP_003109537.1.32289 WP_003109537.1.32314 WP_003109537.1.32359 WP_003109537.1.32523 WP_003109537.1.32544 WP_003109537.1.32596 WP_003109537.1.32641 WP_003109537.1.32711 WP_003109537.1.32879 WP_003109537.1.33047 WP_003109537.1.33097 WP_003109537.1.33133 WP_003109537.1.33152 WP_003109537.1.33186 WP_003109537.1.33204 WP_003109537.1.33210 WP_003109537.1.33216 WP_003109537.1.33294 WP_003109537.1.33340 WP_003109537.1.33387 WP_003109537.1.33438 WP_003109537.1.33455 WP_003109537.1.33517 WP_003109537.1.33521 WP_003109537.1.33523 WP_003109537.1.33547 WP_003109537.1.33549 WP_003109537.1.33658 WP_003109537.1.33669 WP_003109537.1.3368 WP_003109537.1.33733 WP_003109537.1.3376 WP_003109537.1.33774 WP_003109537.1.33814 WP_003109537.1.33822 WP_003109537.1.33824 WP_003109537.1.33833 WP_003109537.1.3385 WP_003109537.1.34000 WP_003109537.1.34039 WP_003109537.1.34143 WP_003109537.1.34151 WP_003109537.1.34180 WP_003109537.1.34191 WP_003109537.1.34203 WP_003109537.1.34306 WP_003109537.1.34317 WP_003109537.1.34324 WP_003109537.1.3436 WP_003109537.1.34401 WP_003109537.1.34402 WP_003109537.1.3452 WP_003109537.1.34556 WP_003109537.1.34568 WP_003109537.1.34583 WP_003109537.1.34689 WP_003109537.1.34832 WP_003109537.1.34837 WP_003109537.1.34876 WP_003109537.1.34878 WP_003109537.1.34901 WP_003109537.1.34922 WP_003109537.1.34942 WP_003109537.1.35104 WP_003109537.1.35149 WP_003109537.1.35231 WP_003109537.1.35281 WP_003109537.1.3531 WP_003109537.1.35353 WP_003109537.1.3540 WP_003109537.1.35442 WP_003109537.1.35480 WP_003109537.1.35512 WP_003109537.1.35573 WP_003109537.1.35599 WP_003109537.1.35669 WP_003109537.1.35679 WP_003109537.1.3568 WP_003109537.1.35682 WP_003109537.1.3576 WP_003109537.1.35762 WP_003109537.1.35768 WP_003109537.1.35843 WP_003109537.1.35857 WP_003109537.1.35872 WP_003109537.1.35968 WP_003109537.1.35984 WP_003109537.1.36064 WP_003109537.1.36121 WP_003109537.1.36170 WP_003109537.1.36266 WP_003109537.1.36267 WP_003109537.1.36378 WP_003109537.1.36435 WP_003109537.1.36487 WP_003109537.1.36521 WP_003109537.1.36587 WP_003109537.1.3662 WP_003109537.1.36630 WP_003109537.1.36665 WP_003109537.1.36756 WP_003109537.1.36879 WP_003109537.1.37050 WP_003109537.1.37125 WP_003109537.1.37163 WP_003109537.1.37208 WP_003109537.1.3721 WP_003109537.1.37216 WP_003109537.1.373 WP_003109537.1.37319 WP_003109537.1.37366 WP_003109537.1.37416 WP_003109537.1.37512 WP_003109537.1.37571 WP_003109537.1.3768 WP_003109537.1.37698 WP_003109537.1.3773 WP_003109537.1.3781 WP_003109537.1.37814 WP_003109537.1.37818 WP_003109537.1.37826 WP_003109537.1.37842 WP_003109537.1.3785 WP_003109537.1.3792 WP_003109537.1.38003 WP_003109537.1.38023 WP_003109537.1.38060 WP_003109537.1.38102 WP_003109537.1.38146 WP_003109537.1.38151 WP_003109537.1.3818 WP_003109537.1.38186 WP_003109537.1.3833 WP_003109537.1.38337 WP_003109537.1.38406 WP_003109537.1.38430 WP_003109537.1.38505 WP_003109537.1.38583 WP_003109537.1.38587 WP_003109537.1.38657 WP_003109537.1.38661 WP_003109537.1.3870 WP_003109537.1.38706 WP_003109537.1.38727 WP_003109537.1.38816 WP_003109537.1.38834 WP_003109537.1.3887 WP_003109537.1.38889 WP_003109537.1.38932 WP_003109537.1.38971 WP_003109537.1.39046 WP_003109537.1.39088 WP_003109537.1.39186 WP_003109537.1.39271 WP_003109537.1.39345 WP_003109537.1.3943 WP_003109537.1.39444 WP_003109537.1.39452 WP_003109537.1.39458 WP_003109537.1.39537 WP_003109537.1.39704 WP_003109537.1.39765 WP_003109537.1.39786 WP_003109537.1.39949 WP_003109537.1.40059 WP_003109537.1.40115 WP_003109537.1.40207 WP_003109537.1.40213 WP_003109537.1.40237 WP_003109537.1.40243 WP_003109537.1.40442 WP_003109537.1.40512 WP_003109537.1.40513 WP_003109537.1.40546 WP_003109537.1.4058 WP_003109537.1.40595 WP_003109537.1.40703 WP_003109537.1.40874 WP_003109537.1.40950 WP_003109537.1.40984 WP_003109537.1.40993 WP_003109537.1.40994 WP_003109537.1.41110 WP_003109537.1.41290 WP_003109537.1.41301 WP_003109537.1.41384 WP_003109537.1.41429 WP_003109537.1.41492 WP_003109537.1.41502 WP_003109537.1.41624 WP_003109537.1.41732 WP_003109537.1.41773 WP_003109537.1.41832 WP_003109537.1.41871 WP_003109537.1.41888 WP_003109537.1.4190 WP_003109537.1.41939 WP_003109537.1.4196 WP_003109537.1.42041 WP_003109537.1.42146 WP_003109537.1.42259 WP_003109537.1.42294 WP_003109537.1.42316 WP_003109537.1.42381 WP_003109537.1.42388 WP_003109537.1.42411 WP_003109537.1.42463 WP_003109537.1.42499 WP_003109537.1.42508 WP_003109537.1.42643 WP_003109537.1.42696 WP_003109537.1.42754 WP_003109537.1.42757 WP_003109537.1.42789 WP_003109537.1.42854 WP_003109537.1.42856 WP_003109537.1.42870 WP_003109537.1.42917 WP_003109537.1.43022 WP_003109537.1.43024 WP_003109537.1.43026 WP_003109537.1.43106 WP_003109537.1.43245 WP_003109537.1.43286 WP_003109537.1.43293 WP_003109537.1.43330 WP_003109537.1.43356 WP_003109537.1.4348 WP_003109537.1.43593 WP_003109537.1.43603 WP_003109537.1.43662 WP_003109537.1.43667 WP_003109537.1.43696 WP_003109537.1.43729 WP_003109537.1.43756 WP_003109537.1.43783 WP_003109537.1.43802 WP_003109537.1.4381 WP_003109537.1.43811 WP_003109537.1.43826 WP_003109537.1.4397 WP_003109537.1.43998 WP_003109537.1.44046 WP_003109537.1.44094 WP_003109537.1.44213 WP_003109537.1.44260 WP_003109537.1.44373 WP_003109537.1.44486 WP_003109537.1.445 WP_003109537.1.44563 WP_003109537.1.44565 WP_003109537.1.44581 WP_003109537.1.44725 WP_003109537.1.44739 WP_003109537.1.44760 WP_003109537.1.44959 WP_003109537.1.45063 WP_003109537.1.45090 WP_003109537.1.45146 WP_003109537.1.45199 WP_003109537.1.45202 WP_003109537.1.4522 WP_003109537.1.45228 WP_003109537.1.45312 WP_003109537.1.4532 WP_003109537.1.45328 WP_003109537.1.45358 WP_003109537.1.45464 WP_003109537.1.45478 WP_003109537.1.45485 WP_003109537.1.45635 WP_003109537.1.45636 WP_003109537.1.45678 WP_003109537.1.45700 WP_003109537.1.45711 WP_003109537.1.45723 WP_003109537.1.45920 WP_003109537.1.45934 WP_003109537.1.45961 WP_003109537.1.46032 WP_003109537.1.46093 WP_003109537.1.461 WP_003109537.1.46152 WP_003109537.1.46200 WP_003109537.1.46306 WP_003109537.1.46436 WP_003109537.1.46502 WP_003109537.1.46623 WP_003109537.1.46633 WP_003109537.1.46826 WP_003109537.1.46846 WP_003109537.1.46866 WP_003109537.1.46885 WP_003109537.1.46926 WP_003109537.1.46935 WP_003109537.1.47101 WP_003109537.1.47150 WP_003109537.1.47155 WP_003109537.1.47251 WP_003109537.1.4726 WP_003109537.1.47296 WP_003109537.1.47469 WP_003109537.1.47480 WP_003109537.1.47598 WP_003109537.1.47645 WP_003109537.1.47774 WP_003109537.1.47930 WP_003109537.1.47970 WP_003109537.1.48001 WP_003109537.1.48024 WP_003109537.1.48086 WP_003109537.1.48094 WP_003109537.1.48141 WP_003109537.1.48172 WP_003109537.1.48178 WP_003109537.1.48321 WP_003109537.1.4836 WP_003109537.1.48378 WP_003109537.1.48382 WP_003109537.1.48413 WP_003109537.1.48472 WP_003109537.1.48487 WP_003109537.1.48545 WP_003109537.1.48747 WP_003109537.1.48810 WP_003109537.1.48820 WP_003109537.1.48842 WP_003109537.1.48851 WP_003109537.1.48870 WP_003109537.1.48961 WP_003109537.1.49108 WP_003109537.1.49184 WP_003109537.1.49244 WP_003109537.1.49265 WP_003109537.1.49266 WP_003109537.1.49277 WP_003109537.1.49286 WP_003109537.1.49293 WP_003109537.1.49360 WP_003109537.1.49416 WP_003109537.1.49500 WP_003109537.1.49566 WP_003109537.1.49688 WP_003109537.1.49798 WP_003109537.1.49806 WP_003109537.1.49833 WP_003109537.1.49842 WP_003109537.1.49922 WP_003109537.1.49948 WP_003109537.1.49976 WP_003109537.1.49988 WP_003109537.1.49998 WP_003109537.1.50176 WP_003109537.1.50180 WP_003109537.1.50242 WP_003109537.1.5043 WP_003109537.1.50653 WP_003109537.1.50668 WP_003109537.1.50682 WP_003109537.1.50691 WP_003109537.1.50734 WP_003109537.1.50967 WP_003109537.1.50989 WP_003109537.1.51019 WP_003109537.1.51136 WP_003109537.1.51173 WP_003109537.1.51183 WP_003109537.1.51267 WP_003109537.1.5132 WP_003109537.1.51472 WP_003109537.1.51501 WP_003109537.1.51538 WP_003109537.1.51585 WP_003109537.1.51682 WP_003109537.1.51727 WP_003109537.1.51807 WP_003109537.1.51847 WP_003109537.1.51889 WP_003109537.1.51928 WP_003109537.1.51937 WP_003109537.1.51943 WP_003109537.1.51957 WP_003109537.1.51976 WP_003109537.1.52146 WP_003109537.1.52152 WP_003109537.1.52212 WP_003109537.1.52220 WP_003109537.1.52244 WP_003109537.1.5226 WP_003109537.1.52334 WP_003109537.1.52355 WP_003109537.1.52409 WP_003109537.1.52449 WP_003109537.1.52500 WP_003109537.1.52537 WP_003109537.1.5258 WP_003109537.1.52583 WP_003109537.1.5260 WP_003109537.1.52690 WP_003109537.1.52697 WP_003109537.1.52700 WP_003109537.1.52728 WP_003109537.1.52784 WP_003109537.1.52790 WP_003109537.1.52810 WP_003109537.1.52850 WP_003109537.1.5294 WP_003109537.1.53038 WP_003109537.1.53070 WP_003109537.1.53072 WP_003109537.1.53267 WP_003109537.1.53287 WP_003109537.1.53351 WP_003109537.1.53371 WP_003109537.1.53414 WP_003109537.1.53486 WP_003109537.1.53530 WP_003109537.1.53663 WP_003109537.1.53678 WP_003109537.1.53719 WP_003109537.1.53726 WP_003109537.1.53826 WP_003109537.1.53932 WP_003109537.1.53948 WP_003109537.1.53951 WP_003109537.1.54078 WP_003109537.1.54090 WP_003109537.1.54133 WP_003109537.1.54146 WP_003109537.1.5420 WP_003109537.1.54248 WP_003109537.1.54293 WP_003109537.1.54354 WP_003109537.1.54462 WP_003109537.1.54571 WP_003109537.1.54742 WP_003109537.1.54809 WP_003109537.1.54974 WP_003109537.1.55089 WP_003109537.1.55169 WP_003109537.1.55347 WP_003109537.1.55387 WP_003109537.1.55400 WP_003109537.1.55445 WP_003109537.1.55478 WP_003109537.1.55543 WP_003109537.1.55813 WP_003109537.1.56013 WP_003109537.1.56145 WP_003109537.1.56171 WP_003109537.1.56187 WP_003109537.1.56188 WP_003109537.1.56196 WP_003109537.1.56229 WP_003109537.1.56315 WP_003109537.1.56348 WP_003109537.1.56442 WP_003109537.1.56465 WP_003109537.1.56474 WP_003109537.1.56475 WP_003109537.1.56626 WP_003109537.1.56632 WP_003109537.1.56745 WP_003109537.1.56797 WP_003109537.1.56808 WP_003109537.1.56819 WP_003109537.1.56973 WP_003109537.1.57005 WP_003109537.1.57020 WP_003109537.1.57113 WP_003109537.1.57131 WP_003109537.1.57140 WP_003109537.1.57276 WP_003109537.1.5731 WP_003109537.1.57339 WP_003109537.1.57369 WP_003109537.1.57417 WP_003109537.1.57460 WP_003109537.1.57532 WP_003109537.1.57548 WP_003109537.1.57566 WP_003109537.1.57728 WP_003109537.1.57792 WP_003109537.1.57839 WP_003109537.1.57853 WP_003109537.1.58056 WP_003109537.1.58162 WP_003109537.1.58183 WP_003109537.1.58193 WP_003109537.1.58200 WP_003109537.1.58228 WP_003109537.1.58294 WP_003109537.1.58360 WP_003109537.1.58436 WP_003109537.1.58482 WP_003109537.1.58510 WP_003109537.1.5856 WP_003109537.1.58689 WP_003109537.1.5869 WP_003109537.1.58785 WP_003109537.1.58800 WP_003109537.1.58944 WP_003109537.1.58952 WP_003109537.1.59013 WP_003109537.1.59076 WP_003109537.1.59158 WP_003109537.1.59176 WP_003109537.1.59212 WP_003109537.1.59246 WP_003109537.1.59250 WP_003109537.1.5937 WP_003109537.1.59376 WP_003109537.1.594 WP_003109537.1.59469 WP_003109537.1.59563 WP_003109537.1.59724 WP_003109537.1.59759 WP_003109537.1.59831 WP_003109537.1.59870 WP_003109537.1.60051 WP_003109537.1.60079 WP_003109537.1.60082 WP_003109537.1.60084 WP_003109537.1.60347 WP_003109537.1.60415 WP_003109537.1.60472 WP_003109537.1.60509 WP_003109537.1.60600 WP_003109537.1.60602 WP_003109537.1.60603 WP_003109537.1.60639 WP_003109537.1.60679 WP_003109537.1.60686 WP_003109537.1.607 WP_003109537.1.60850 WP_003109537.1.60910 WP_003109537.1.60916 WP_003109537.1.61130 WP_003109537.1.61191 WP_003109537.1.61209 WP_003109537.1.61222 WP_003109537.1.61299 WP_003109537.1.6130 WP_003109537.1.61366 WP_003109537.1.61431 WP_003109537.1.61493 WP_003109537.1.61549 WP_003109537.1.61589 WP_003109537.1.61598 WP_003109537.1.6173 WP_003109537.1.62010 WP_003109537.1.62035 WP_003109537.1.62186 WP_003109537.1.62211 WP_003109537.1.62357 WP_003109537.1.62396 WP_003109537.1.62410 WP_003109537.1.6242 WP_003109537.1.62483 WP_003109537.1.62516 WP_003109537.1.62534 WP_003109537.1.62604 WP_003109537.1.62635 WP_003109537.1.62688 WP_003109537.1.62701 WP_003109537.1.62703 WP_003109537.1.62704 WP_003109537.1.62708 WP_003109537.1.62716 WP_003109537.1.62768 WP_003109537.1.62772 WP_003109537.1.6283 WP_003109537.1.62834 WP_003109537.1.62838 WP_003109537.1.62873 WP_003109537.1.62917 WP_003109537.1.62977 WP_003109537.1.63041 WP_003109537.1.63193 WP_003109537.1.63196 WP_003109537.1.63338 WP_003109537.1.63369 WP_003109537.1.63401 WP_003109537.1.63591 WP_003109537.1.63597 WP_003109537.1.63634 WP_003109537.1.63659 WP_003109537.1.63739 WP_003109537.1.63784 WP_003109537.1.64139 WP_003109537.1.64155 WP_003109537.1.64212 WP_003109537.1.64329 WP_003109537.1.64340 WP_003109537.1.6450 WP_003109537.1.64544 WP_003109537.1.64591 WP_003109537.1.64603 WP_003109537.1.6461 WP_003109537.1.64726 WP_003109537.1.64807 WP_003109537.1.64854 WP_003109537.1.64862 WP_003109537.1.64880 WP_003109537.1.64885 WP_003109537.1.64886 WP_003109537.1.64983 WP_003109537.1.64984 WP_003109537.1.65066 WP_003109537.1.65099 WP_003109537.1.65145 WP_003109537.1.65196 WP_003109537.1.65197 WP_003109537.1.65237 WP_003109537.1.65247 WP_003109537.1.65304 WP_003109537.1.65312 WP_003109537.1.65316 WP_003109537.1.65334 WP_003109537.1.65335 WP_003109537.1.65457 WP_003109537.1.65549 WP_003109537.1.65588 WP_003109537.1.65632 WP_003109537.1.65642 WP_003109537.1.65679 WP_003109537.1.65740 WP_003109537.1.65779 WP_003109537.1.65819 WP_003109537.1.65867 WP_003109537.1.6589 WP_003109537.1.65926 WP_003109537.1.66062 WP_003109537.1.66155 WP_003109537.1.66165 WP_003109537.1.6627 WP_003109537.1.66277 WP_003109537.1.66345 WP_003109537.1.66348 WP_003109537.1.66364 WP_003109537.1.66526 WP_003109537.1.66563 WP_003109537.1.66634 WP_003109537.1.66721 WP_003109537.1.66892 WP_003109537.1.66929 WP_003109537.1.66950 WP_003109537.1.66982 WP_003109537.1.67010 WP_003109537.1.67188 WP_003109537.1.67192 WP_003109537.1.67205 WP_003109537.1.67261 WP_003109537.1.67269 WP_003109537.1.6734 WP_003109537.1.67370 WP_003109537.1.67388 WP_003109537.1.67472 WP_003109537.1.67489 WP_003109537.1.67506 WP_003109537.1.67526 WP_003109537.1.67545 WP_003109537.1.6768 WP_003109537.1.67686 WP_003109537.1.67755 WP_003109537.1.67830 WP_003109537.1.67899 WP_003109537.1.67948 WP_003109537.1.68000 WP_003109537.1.6808 WP_003109537.1.68158 WP_003109537.1.68162 WP_003109537.1.68172 WP_003109537.1.68183 WP_003109537.1.68194 WP_003109537.1.68252 WP_003109537.1.68317 WP_003109537.1.68499 WP_003109537.1.6850 WP_003109537.1.68561 WP_003109537.1.68568 WP_003109537.1.68638 WP_003109537.1.68756 WP_003109537.1.68781 WP_003109537.1.68790 WP_003109537.1.68800 WP_003109537.1.68802 WP_003109537.1.68850 WP_003109537.1.68857 WP_003109537.1.68862 WP_003109537.1.68910 WP_003109537.1.68938 WP_003109537.1.68979 WP_003109537.1.69088 WP_003109537.1.6911 WP_003109537.1.69159 WP_003109537.1.69260 WP_003109537.1.6928 WP_003109537.1.6931 WP_003109537.1.6937 WP_003109537.1.69411 WP_003109537.1.69534 WP_003109537.1.69556 WP_003109537.1.69702 WP_003109537.1.69788 WP_003109537.1.69791 WP_003109537.1.69819 WP_003109537.1.69834 WP_003109537.1.69907 WP_003109537.1.69993 WP_003109537.1.70092 WP_003109537.1.70098 WP_003109537.1.70138 WP_003109537.1.70194 WP_003109537.1.70216 WP_003109537.1.70229 WP_003109537.1.70331 WP_003109537.1.70460 WP_003109537.1.70470 WP_003109537.1.70537 WP_003109537.1.70561 WP_003109537.1.70583 WP_003109537.1.70648 WP_003109537.1.70670 WP_003109537.1.70677 WP_003109537.1.7077 WP_003109537.1.70778 WP_003109537.1.70831 WP_003109537.1.71038 WP_003109537.1.71141 WP_003109537.1.71203 WP_003109537.1.71249 WP_003109537.1.71254 WP_003109537.1.71385 WP_003109537.1.71412 WP_003109537.1.71570 WP_003109537.1.7163 WP_003109537.1.71642 WP_003109537.1.71799 WP_003109537.1.71806 WP_003109537.1.71822 WP_003109537.1.71862 WP_003109537.1.72167 WP_003109537.1.72181 WP_003109537.1.72183 WP_003109537.1.72287 WP_003109537.1.72323 WP_003109537.1.72331 WP_003109537.1.72346 WP_003109537.1.72378 WP_003109537.1.72447 WP_003109537.1.72458 WP_003109537.1.72541 WP_003109537.1.72562 WP_003109537.1.72669 WP_003109537.1.72727 WP_003109537.1.7276 WP_003109537.1.72768 WP_003109537.1.72772 WP_003109537.1.72920 WP_003109537.1.73048 WP_003109537.1.73135 WP_003109537.1.73149 WP_003109537.1.73172 WP_003109537.1.73192 WP_003109537.1.7327 WP_003109537.1.7329 WP_003109537.1.733 WP_003109537.1.73455 WP_003109537.1.73523 WP_003109537.1.73651 WP_003109537.1.73719 WP_003109537.1.7377 WP_003109537.1.7382 WP_003109537.1.73860 WP_003109537.1.73889 WP_003109537.1.73911 WP_003109537.1.74 WP_003109537.1.74074 WP_003109537.1.7408 WP_003109537.1.74106 WP_003109537.1.74167 WP_003109537.1.74180 WP_003109537.1.74219 WP_003109537.1.74264 WP_003109537.1.74268 WP_003109537.1.74281 WP_003109537.1.74326 WP_003109537.1.7445 WP_003109537.1.74458 WP_003109537.1.74473 WP_003109537.1.74518 WP_003109537.1.7456 WP_003109537.1.74568 WP_003109537.1.74604 WP_003109537.1.74637 WP_003109537.1.74685 WP_003109537.1.74772 WP_003109537.1.74776 WP_003109537.1.748 WP_003109537.1.74878 WP_003109537.1.74948 WP_003109537.1.75041 WP_003109537.1.75303 WP_003109537.1.75431 WP_003109537.1.7547 WP_003109537.1.75549 WP_003109537.1.75573 WP_003109537.1.75580 WP_003109537.1.75599 WP_003109537.1.75603 WP_003109537.1.75631 WP_003109537.1.75771 WP_003109537.1.75825 WP_003109537.1.75826 WP_003109537.1.75860 WP_003109537.1.75935 WP_003109537.1.75938 WP_003109537.1.75947 WP_003109537.1.7595 WP_003109537.1.76077 WP_003109537.1.76092 WP_003109537.1.76141 WP_003109537.1.76145 WP_003109537.1.76192 WP_003109537.1.76322 WP_003109537.1.76355 WP_003109537.1.76383 WP_003109537.1.76399 WP_003109537.1.76441 WP_003109537.1.76467 WP_003109537.1.76484 WP_003109537.1.76543 WP_003109537.1.76600 WP_003109537.1.76633 WP_003109537.1.7666 WP_003109537.1.76716 WP_003109537.1.76775 WP_003109537.1.76861 WP_003109537.1.76922 WP_003109537.1.77235 WP_003109537.1.77286 WP_003109537.1.77317 WP_003109537.1.77490 WP_003109537.1.77566 WP_003109537.1.77574 WP_003109537.1.77686 WP_003109537.1.77750 WP_003109537.1.77769 WP_003109537.1.77819 WP_003109537.1.77834 WP_003109537.1.78104 WP_003109537.1.78112 WP_003109537.1.78118 WP_003109537.1.78134 WP_003109537.1.78148 WP_003109537.1.78158 WP_003109537.1.78280 WP_003109537.1.78288 WP_003109537.1.78380 WP_003109537.1.78425 WP_003109537.1.78430 WP_003109537.1.78437 WP_003109537.1.78570 WP_003109537.1.78669 WP_003109537.1.78693 WP_003109537.1.78795 WP_003109537.1.788 WP_003109537.1.78810 WP_003109537.1.78926 WP_003109537.1.78947 WP_003109537.1.78954 WP_003109537.1.78986 WP_003109537.1.7899 WP_003109537.1.79007 WP_003109537.1.79053 WP_003109537.1.79177 WP_003109537.1.79193 WP_003109537.1.79256 WP_003109537.1.79286 WP_003109537.1.79311 WP_003109537.1.79357 WP_003109537.1.79364 WP_003109537.1.79421 WP_003109537.1.79429 WP_003109537.1.79463 WP_003109537.1.79507 WP_003109537.1.7953 WP_003109537.1.79544 WP_003109537.1.79569 WP_003109537.1.79631 WP_003109537.1.79754 WP_003109537.1.79788 WP_003109537.1.79883 WP_003109537.1.799 WP_003109537.1.79902 WP_003109537.1.79908 WP_003109537.1.79986 WP_003109537.1.8 WP_003109537.1.80033 WP_003109537.1.80102 WP_003109537.1.8013 WP_003109537.1.80174 WP_003109537.1.80258 WP_003109537.1.8028 WP_003109537.1.80306 WP_003109537.1.8038 WP_003109537.1.80410 WP_003109537.1.80411 WP_003109537.1.80454 WP_003109537.1.80481 WP_003109537.1.8051 WP_003109537.1.80627 WP_003109537.1.80632 WP_003109537.1.8064 WP_003109537.1.80644 WP_003109537.1.80683 WP_003109537.1.80720 WP_003109537.1.80785 WP_003109537.1.80846 WP_003109537.1.80880 WP_003109537.1.80892 WP_003109537.1.80910 WP_003109537.1.80929 WP_003109537.1.80931 WP_003109537.1.80938 WP_003109537.1.81206 WP_003109537.1.81331 WP_003109537.1.81380 WP_003109537.1.81426 WP_003109537.1.81470 WP_003109537.1.81482 WP_003109537.1.81487 WP_003109537.1.81622 WP_003109537.1.81643 WP_003109537.1.81742 WP_003109537.1.81748 WP_003109537.1.81771 WP_003109537.1.81784 WP_003109537.1.81834 WP_003109537.1.81844 WP_003109537.1.81856 WP_003109537.1.81874 WP_003109537.1.81927 WP_003109537.1.81950 WP_003109537.1.81957 WP_003109537.1.81960 WP_003109537.1.82117 WP_003109537.1.82178 WP_003109537.1.82260 WP_003109537.1.8227 WP_003109537.1.82310 WP_003109537.1.82312 WP_003109537.1.82328 WP_003109537.1.82334 WP_003109537.1.8238 WP_003109537.1.82442 WP_003109537.1.82487 WP_003109537.1.82580 WP_003109537.1.82604 WP_003109537.1.82606 WP_003109537.1.82643 WP_003109537.1.8284 WP_003109537.1.82864 WP_003109537.1.82887 WP_003109537.1.83025 WP_003109537.1.83131 WP_003109537.1.83184 WP_003109537.1.83251 WP_003109537.1.83267 WP_003109537.1.83296 WP_003109537.1.83317 WP_003109537.1.83374 WP_003109537.1.83394 WP_003109537.1.83440 WP_003109537.1.83460 WP_003109537.1.83463 WP_003109537.1.835 WP_003109537.1.83503 WP_003109537.1.8353 WP_003109537.1.83534 WP_003109537.1.83540 WP_003109537.1.8357 WP_003109537.1.83637 WP_003109537.1.83698 WP_003109537.1.83946 WP_003109537.1.84003 WP_003109537.1.84008 WP_003109537.1.84138 WP_003109537.1.84162 WP_003109537.1.84174 WP_003109537.1.84177 WP_003109537.1.84190 WP_003109537.1.84203 WP_003109537.1.84271 WP_003109537.1.84297 WP_003109537.1.84374 WP_003109537.1.84398 WP_003109537.1.84526 WP_003109537.1.8453 WP_003109537.1.84558 WP_003109537.1.84589 WP_003109537.1.84674 WP_003109537.1.84702 WP_003109537.1.84715 WP_003109537.1.84754 WP_003109537.1.84792 WP_003109537.1.8484 WP_003109537.1.84937 WP_003109537.1.84946 WP_003109537.1.8498 WP_003109537.1.85018 WP_003109537.1.85028 WP_003109537.1.85059 WP_003109537.1.85150 WP_003109537.1.85290 WP_003109537.1.85298 WP_003109537.1.85303 WP_003109537.1.85311 WP_003109537.1.85318 WP_003109537.1.85357 WP_003109537.1.85446 WP_003109537.1.85453 WP_003109537.1.85574 WP_003109537.1.85633 WP_003109537.1.85638 WP_003109537.1.85897 WP_003109537.1.85920 WP_003109537.1.86002 WP_003109537.1.86047 WP_003109537.1.86055 WP_003109537.1.86058 WP_003109537.1.86278 WP_003109537.1.86287 WP_003109537.1.86293 WP_003109537.1.86432 WP_003109537.1.865 WP_003109537.1.86545 WP_003109537.1.86552 WP_003109537.1.86554 WP_003109537.1.86652 WP_003109537.1.86665 WP_003109537.1.867 WP_003109537.1.86774 WP_003109537.1.86780 WP_003109537.1.86785 WP_003109537.1.86796 WP_003109537.1.8693 WP_003109537.1.86970 WP_003109537.1.86985 WP_003109537.1.87163 WP_003109537.1.8718 WP_003109537.1.87182 WP_003109537.1.87183 WP_003109537.1.87316 WP_003109537.1.87390 WP_003109537.1.87435 WP_003109537.1.87463 WP_003109537.1.8749 WP_003109537.1.87530 WP_003109537.1.87547 WP_003109537.1.87648 WP_003109537.1.87763 WP_003109537.1.8777 WP_003109537.1.8785 WP_003109537.1.87877 WP_003109537.1.87888 WP_003109537.1.87970 WP_003109537.1.87981 WP_003109537.1.87987 WP_003109537.1.88004 WP_003109537.1.88308 WP_003109537.1.88330 WP_003109537.1.88360 WP_003109537.1.88388 WP_003109537.1.8852 WP_003109537.1.88540 WP_003109537.1.88550 WP_003109537.1.88578 WP_003109537.1.88605 WP_003109537.1.88659 WP_003109537.1.88680 WP_003109537.1.88714 WP_003109537.1.88750 WP_003109537.1.88796 WP_003109537.1.88900 WP_003109537.1.88969 WP_003109537.1.89083 WP_003109537.1.8911 WP_003109537.1.89245 WP_003109537.1.89276 WP_003109537.1.89330 WP_003109537.1.89409 WP_003109537.1.89434 WP_003109537.1.89440 WP_003109537.1.89480 WP_003109537.1.89577 WP_003109537.1.89610 WP_003109537.1.89662 WP_003109537.1.89669 WP_003109537.1.89736 WP_003109537.1.8976 WP_003109537.1.89805 WP_003109537.1.89866 WP_003109537.1.89867 WP_003109537.1.89868 WP_003109537.1.89871 WP_003109537.1.89886 WP_003109537.1.89992 WP_003109537.1.90056 WP_003109537.1.90110 WP_003109537.1.90141 WP_003109537.1.90189 WP_003109537.1.90224 WP_003109537.1.90242 WP_003109537.1.90268 WP_003109537.1.90306 WP_003109537.1.90412 WP_003109537.1.9056 WP_003109537.1.90569 WP_003109537.1.90655 WP_003109537.1.90770 WP_003109537.1.90999 WP_003109537.1.91093 WP_003109537.1.91161 WP_003109537.1.9120 WP_003109537.1.91204 WP_003109537.1.91336 WP_003109537.1.91360 WP_003109537.1.91392 WP_003109537.1.91416 WP_003109537.1.9143 WP_003109537.1.91431 WP_003109537.1.91467 WP_003109537.1.91585 WP_003109537.1.91796 WP_003109537.1.91803 WP_003109537.1.9182 WP_003109537.1.91838 WP_003109537.1.91860 WP_003109537.1.91862 WP_003109537.1.9191 WP_003109537.1.92043 WP_003109537.1.92175 WP_003109537.1.9219 WP_003109537.1.92314 WP_003109537.1.92321 WP_003109537.1.92357 WP_003109537.1.92454 WP_003109537.1.92573 WP_003109537.1.92585 WP_003109537.1.92589 WP_003109537.1.92594 WP_003109537.1.92630 WP_003109537.1.92642 WP_003109537.1.9272 WP_003109537.1.92769 WP_003109537.1.92839 WP_003109537.1.92930 WP_003109537.1.93001 WP_003109537.1.93144 WP_003109537.1.93250 WP_003109537.1.93264 WP_003109537.1.9328 WP_003109537.1.93446 WP_003109537.1.9349 WP_003109537.1.93493 WP_003109537.1.93498 WP_003109537.1.93547 WP_003109537.1.93562 WP_003109537.1.93568 WP_003109537.1.93797 WP_003109537.1.93848 WP_003109537.1.93889 WP_003109537.1.94004 WP_003109537.1.94031 WP_003109537.1.94078 WP_003109537.1.94136 WP_003109537.1.94174 WP_003109537.1.94211 WP_003109537.1.94218 WP_003109537.1.94243 WP_003109537.1.94285 WP_003109537.1.94333 WP_003109537.1.94349 WP_003109537.1.94385 WP_003109537.1.94434 WP_003109537.1.9444 WP_003109537.1.94450 WP_003109537.1.94682 WP_003109537.1.94732 WP_003109537.1.94742 WP_003109537.1.94814 WP_003109537.1.94856 WP_003109537.1.94896 WP_003109537.1.94897 WP_003109537.1.94943 WP_003109537.1.95027 WP_003109537.1.95056 WP_003109537.1.95117 WP_003109537.1.95132 WP_003109537.1.95187 WP_003109537.1.95207 WP_003109537.1.95217 WP_003109537.1.95305 WP_003109537.1.95359 WP_003109537.1.95460 WP_003109537.1.95488 WP_003109537.1.95525 WP_003109537.1.95536 WP_003109537.1.95638 WP_003109537.1.95668 WP_003109537.1.95782 WP_003109537.1.95802 WP_003109537.1.95820 WP_003109537.1.95825 WP_003109537.1.95959 WP_003109537.1.95999 WP_003109537.1.96008 WP_003109537.1.9604 WP_003109537.1.96058 WP_003109537.1.961 WP_003109537.1.96243 WP_003109537.1.96267 WP_003109537.1.96357 WP_003109537.1.96384 WP_003109537.1.96452 WP_003109537.1.96506 WP_003109537.1.96702 WP_003109537.1.96967 WP_003109537.1.9706 WP_003109537.1.97118 WP_003109537.1.97126 WP_003109537.1.97213 WP_003109537.1.9722 WP_003109537.1.97271 WP_003109537.1.97272 WP_003109537.1.97461 WP_003109537.1.97474 WP_003109537.1.97499 WP_003109537.1.97521 WP_003109537.1.97614 WP_003109537.1.977 WP_003109537.1.97826 WP_003109537.1.97968 WP_003109537.1.98276 WP_003109537.1.98410 WP_003109537.1.98414 WP_003109537.1.98433 WP_003109537.1.9845 WP_003109537.1.985 WP_003109537.1.98515 WP_003109537.1.98522 WP_003109537.1.98573 WP_003109537.1.98600 WP_003109537.1.98610 WP_003109537.1.98693 WP_003109537.1.98788 WP_003109537.1.9885 WP_003109537.1.98873 WP_003109537.1.98960 WP_003109537.1.99065 WP_003109537.1.99068 WP_003109537.1.99103 WP_003109537.1.99293 WP_003109537.1.99378 WP_003109537.1.99386 WP_003109537.1.99389 WP_003109537.1.99443 WP_003109537.1.9951 WP_003109537.1.99516 WP_003109537.1.99647 WP_003109537.1.99654 WP_003109537.1.99662 WP_003109537.1.99746 WP_003109537.1.99757 WP_003109537.1.99772 WP_003109537.1.99795 WP_003109537.1.99835 WP_003109537.1.9989 WP_003109537.1.99930 gi|568153934|ref|YP_008942912.1| gi|386058586|ref|YP_005975108.1| gi|218891506|ref|YP_002440373.1| gi|116050460|ref|YP_790721.1| gi|558666272|ref|YP_008802982.1| gi|564952398|ref|YP_008884968.1| gi|558672623|ref|YP_008809331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]