SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153936|ref|YP_008942914.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153936|ref|YP_008942914.1|
Domain Number 1 Region: 204-336
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.42e-37
Family Aromatic dioxygenase reductase-like 0.001
Further Details:      
 
Domain Number 2 Region: 107-204
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.09e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00059
Further Details:      
 
Domain Number 3 Region: 3-88
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.84e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568153936|ref|YP_008942914.1|
Sequence length 340
Comment anthranilate dioxygenase reductase [Pseudomonas aeruginosa LES431]
Sequence
MNHKVALSFADGKTLFLPVGHDDLLLDAALRHGINLPLDCREGVCGTCMGRCEAGSYSLD
YADEDTLSAADLEQRKVLACQTRVRSDAAFYFDFASTLCHAAAAQAHSGVVRELRLLSED
TALLRLDAGAAGRQLDFLPGQYARLQVPGSDCRRAYSFANRPNPQNHLQFLIRLLPGGAM
SDYLRQGCRVGDEIRFEAPLGTFYLRQVERPLLLVAGGTGLSAFLGMLDELAERGCERPV
HLYYGVRRAADLCELQRIAGYAERLPGFRFVPVLSEADADWDGRRGYLHEHFDAARLRDE
AFDLYLCGPPPMVEAVRQWLREHSLEHLRLYLEKFTESGD
Download sequence
Identical sequences A0A0M4PD27
WP_003116863.1.100100 WP_003116863.1.100473 WP_003116863.1.100808 WP_003116863.1.100983 WP_003116863.1.101739 WP_003116863.1.101809 WP_003116863.1.101819 WP_003116863.1.10185 WP_003116863.1.101871 WP_003116863.1.10201 WP_003116863.1.10257 WP_003116863.1.1037 WP_003116863.1.10457 WP_003116863.1.10482 WP_003116863.1.10636 WP_003116863.1.11026 WP_003116863.1.11454 WP_003116863.1.11943 WP_003116863.1.12018 WP_003116863.1.12240 WP_003116863.1.13232 WP_003116863.1.13315 WP_003116863.1.13407 WP_003116863.1.13828 WP_003116863.1.1393 WP_003116863.1.14378 WP_003116863.1.14714 WP_003116863.1.1475 WP_003116863.1.14835 WP_003116863.1.14839 WP_003116863.1.152 WP_003116863.1.15222 WP_003116863.1.15231 WP_003116863.1.15281 WP_003116863.1.15373 WP_003116863.1.15480 WP_003116863.1.15886 WP_003116863.1.16808 WP_003116863.1.17155 WP_003116863.1.18117 WP_003116863.1.18199 WP_003116863.1.1824 WP_003116863.1.18735 WP_003116863.1.19376 WP_003116863.1.1971 WP_003116863.1.19741 WP_003116863.1.20125 WP_003116863.1.20682 WP_003116863.1.21469 WP_003116863.1.21517 WP_003116863.1.21718 WP_003116863.1.21871 WP_003116863.1.21891 WP_003116863.1.221 WP_003116863.1.2228 WP_003116863.1.22324 WP_003116863.1.22365 WP_003116863.1.22442 WP_003116863.1.22477 WP_003116863.1.22573 WP_003116863.1.22729 WP_003116863.1.22863 WP_003116863.1.23013 WP_003116863.1.23195 WP_003116863.1.2323 WP_003116863.1.23331 WP_003116863.1.23512 WP_003116863.1.23525 WP_003116863.1.23611 WP_003116863.1.23715 WP_003116863.1.23782 WP_003116863.1.24087 WP_003116863.1.24351 WP_003116863.1.2453 WP_003116863.1.24851 WP_003116863.1.24862 WP_003116863.1.24938 WP_003116863.1.251 WP_003116863.1.25142 WP_003116863.1.25271 WP_003116863.1.2596 WP_003116863.1.26042 WP_003116863.1.26159 WP_003116863.1.26428 WP_003116863.1.26463 WP_003116863.1.2652 WP_003116863.1.26592 WP_003116863.1.26681 WP_003116863.1.26705 WP_003116863.1.26816 WP_003116863.1.27211 WP_003116863.1.27259 WP_003116863.1.27587 WP_003116863.1.27687 WP_003116863.1.27837 WP_003116863.1.27966 WP_003116863.1.28064 WP_003116863.1.28136 WP_003116863.1.28383 WP_003116863.1.29062 WP_003116863.1.29137 WP_003116863.1.2927 WP_003116863.1.29481 WP_003116863.1.29498 WP_003116863.1.29577 WP_003116863.1.30254 WP_003116863.1.30994 WP_003116863.1.31279 WP_003116863.1.31361 WP_003116863.1.31501 WP_003116863.1.32144 WP_003116863.1.32544 WP_003116863.1.32596 WP_003116863.1.33210 WP_003116863.1.33340 WP_003116863.1.33517 WP_003116863.1.33549 WP_003116863.1.3376 WP_003116863.1.33774 WP_003116863.1.33822 WP_003116863.1.34317 WP_003116863.1.34401 WP_003116863.1.34689 WP_003116863.1.34832 WP_003116863.1.34878 WP_003116863.1.35149 WP_003116863.1.35599 WP_003116863.1.35762 WP_003116863.1.35822 WP_003116863.1.35857 WP_003116863.1.35984 WP_003116863.1.36630 WP_003116863.1.36665 WP_003116863.1.37097 WP_003116863.1.37319 WP_003116863.1.37366 WP_003116863.1.3833 WP_003116863.1.38337 WP_003116863.1.38971 WP_003116863.1.39088 WP_003116863.1.39122 WP_003116863.1.39345 WP_003116863.1.39704 WP_003116863.1.40059 WP_003116863.1.40546 WP_003116863.1.41384 WP_003116863.1.41748 WP_003116863.1.42019 WP_003116863.1.42259 WP_003116863.1.42508 WP_003116863.1.42643 WP_003116863.1.42789 WP_003116863.1.42854 WP_003116863.1.42856 WP_003116863.1.42973 WP_003116863.1.43024 WP_003116863.1.43026 WP_003116863.1.43106 WP_003116863.1.43107 WP_003116863.1.43356 WP_003116863.1.43662 WP_003116863.1.44373 WP_003116863.1.44434 WP_003116863.1.445 WP_003116863.1.44739 WP_003116863.1.45063 WP_003116863.1.45090 WP_003116863.1.45199 WP_003116863.1.45228 WP_003116863.1.45358 WP_003116863.1.45485 WP_003116863.1.45934 WP_003116863.1.46152 WP_003116863.1.46200 WP_003116863.1.46623 WP_003116863.1.46787 WP_003116863.1.47469 WP_003116863.1.47774 WP_003116863.1.47930 WP_003116863.1.48024 WP_003116863.1.48382 WP_003116863.1.48545 WP_003116863.1.49266 WP_003116863.1.49293 WP_003116863.1.49842 WP_003116863.1.49988 WP_003116863.1.50567 WP_003116863.1.50668 WP_003116863.1.5132 WP_003116863.1.51501 WP_003116863.1.51549 WP_003116863.1.51847 WP_003116863.1.5226 WP_003116863.1.52690 WP_003116863.1.52697 WP_003116863.1.5294 WP_003116863.1.53267 WP_003116863.1.53371 WP_003116863.1.53486 WP_003116863.1.53663 WP_003116863.1.55318 WP_003116863.1.55400 WP_003116863.1.56145 WP_003116863.1.56187 WP_003116863.1.56442 WP_003116863.1.56475 WP_003116863.1.56797 WP_003116863.1.57131 WP_003116863.1.58019 WP_003116863.1.58056 WP_003116863.1.58228 WP_003116863.1.58527 WP_003116863.1.59076 WP_003116863.1.59688 WP_003116863.1.59797 WP_003116863.1.60415 WP_003116863.1.60600 WP_003116863.1.60603 WP_003116863.1.60639 WP_003116863.1.607 WP_003116863.1.61431 WP_003116863.1.62010 WP_003116863.1.62410 WP_003116863.1.6242 WP_003116863.1.62516 WP_003116863.1.62534 WP_003116863.1.62688 WP_003116863.1.62701 WP_003116863.1.62917 WP_003116863.1.63338 WP_003116863.1.63659 WP_003116863.1.63995 WP_003116863.1.64198 WP_003116863.1.64309 WP_003116863.1.64340 WP_003116863.1.64603 WP_003116863.1.64726 WP_003116863.1.64799 WP_003116863.1.65092 WP_003116863.1.65099 WP_003116863.1.65237 WP_003116863.1.65247 WP_003116863.1.65549 WP_003116863.1.65867 WP_003116863.1.66526 WP_003116863.1.67192 WP_003116863.1.67388 WP_003116863.1.67686 WP_003116863.1.67948 WP_003116863.1.68000 WP_003116863.1.68862 WP_003116863.1.68910 WP_003116863.1.69088 WP_003116863.1.6928 WP_003116863.1.69788 WP_003116863.1.70098 WP_003116863.1.70216 WP_003116863.1.70460 WP_003116863.1.70561 WP_003116863.1.71385 WP_003116863.1.71822 WP_003116863.1.72149 WP_003116863.1.72331 WP_003116863.1.72653 WP_003116863.1.73149 WP_003116863.1.73172 WP_003116863.1.74106 WP_003116863.1.74268 WP_003116863.1.7445 WP_003116863.1.74518 WP_003116863.1.7456 WP_003116863.1.74948 WP_003116863.1.75303 WP_003116863.1.7547 WP_003116863.1.75771 WP_003116863.1.75938 WP_003116863.1.76322 WP_003116863.1.76383 WP_003116863.1.76399 WP_003116863.1.76633 WP_003116863.1.77286 WP_003116863.1.77566 WP_003116863.1.77574 WP_003116863.1.77769 WP_003116863.1.78112 WP_003116863.1.78134 WP_003116863.1.78409 WP_003116863.1.78430 WP_003116863.1.78693 WP_003116863.1.78810 WP_003116863.1.78947 WP_003116863.1.78954 WP_003116863.1.79053 WP_003116863.1.79256 WP_003116863.1.79429 WP_003116863.1.7945 WP_003116863.1.79507 WP_003116863.1.79601 WP_003116863.1.79908 WP_003116863.1.79986 WP_003116863.1.8028 WP_003116863.1.80411 WP_003116863.1.80627 WP_003116863.1.80632 WP_003116863.1.80720 WP_003116863.1.80880 WP_003116863.1.80938 WP_003116863.1.81082 WP_003116863.1.81331 WP_003116863.1.81482 WP_003116863.1.81487 WP_003116863.1.81957 WP_003116863.1.81960 WP_003116863.1.82310 WP_003116863.1.82936 WP_003116863.1.83131 WP_003116863.1.8357 WP_003116863.1.83698 WP_003116863.1.83715 WP_003116863.1.84174 WP_003116863.1.84177 WP_003116863.1.84374 WP_003116863.1.84398 WP_003116863.1.84589 WP_003116863.1.84937 WP_003116863.1.85220 WP_003116863.1.85910 WP_003116863.1.86002 WP_003116863.1.86047 WP_003116863.1.86125 WP_003116863.1.86287 WP_003116863.1.86545 WP_003116863.1.86785 WP_003116863.1.86985 WP_003116863.1.87163 WP_003116863.1.87390 WP_003116863.1.87435 WP_003116863.1.87547 WP_003116863.1.87970 WP_003116863.1.87981 WP_003116863.1.87987 WP_003116863.1.88330 WP_003116863.1.88680 WP_003116863.1.89245 WP_003116863.1.89434 WP_003116863.1.89867 WP_003116863.1.89868 WP_003116863.1.90150 WP_003116863.1.90189 WP_003116863.1.90225 WP_003116863.1.90655 WP_003116863.1.91093 WP_003116863.1.91204 WP_003116863.1.91431 WP_003116863.1.91803 WP_003116863.1.92454 WP_003116863.1.92585 WP_003116863.1.92589 WP_003116863.1.9272 WP_003116863.1.92769 WP_003116863.1.92847 WP_003116863.1.92930 WP_003116863.1.93498 WP_003116863.1.94031 WP_003116863.1.94174 WP_003116863.1.94243 WP_003116863.1.9444 WP_003116863.1.94874 WP_003116863.1.95132 WP_003116863.1.95460 WP_003116863.1.96193 WP_003116863.1.9706 WP_003116863.1.9722 WP_003116863.1.97272 WP_003116863.1.9885 WP_003116863.1.99757 gi|568153936|ref|YP_008942914.1| gi|558672621|ref|YP_008809329.1| gi|218891508|ref|YP_002440375.1| gi|392983931|ref|YP_006482518.1| gi|558666270|ref|YP_008802980.1| gi|568309534|ref|YP_008981803.1| 557722.PLES_27811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]