SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153976|ref|YP_008942954.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153976|ref|YP_008942954.1|
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.1e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.17e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568153976|ref|YP_008942954.1|
Sequence length 214
Comment maleylacetoacetate isomerase [Pseudomonas aeruginosa LES431]
Sequence
MQLYSFFNSSTSYRVRIALALKGLDYQVVPVNLRQGEQLRPADRQRNPMGALPTLVDADG
RRFSQSLAIIDYLDAVQPEPRLIPLDPLHRAQALELALLVACDIHPLNNVRVLKYLTQVL
GIDAEDRQRWYAHWVAEGLAAAETLLNRHRRGAFFAGAAAGIVECCLVPQLANARRMGCD
LAPYPALLELEGRCLALEAFQRASPERQPDYLPD
Download sequence
Identical sequences A0A0C7CR18 A0A1E9BZT1 A0A1F0J465 A0A1S1CA93 Q9I109 W1MK09
gi|386058629|ref|YP_005975151.1| NP_251163.1.87394 WP_003113293.1.100071 WP_003113293.1.100179 WP_003113293.1.100394 WP_003113293.1.100420 WP_003113293.1.100476 WP_003113293.1.100523 WP_003113293.1.100654 WP_003113293.1.100723 WP_003113293.1.100777 WP_003113293.1.100786 WP_003113293.1.100808 WP_003113293.1.100809 WP_003113293.1.100810 WP_003113293.1.100872 WP_003113293.1.100983 WP_003113293.1.100995 WP_003113293.1.101021 WP_003113293.1.101090 WP_003113293.1.101506 WP_003113293.1.101642 WP_003113293.1.101712 WP_003113293.1.101809 WP_003113293.1.101863 WP_003113293.1.10201 WP_003113293.1.10204 WP_003113293.1.102045 WP_003113293.1.1037 WP_003113293.1.10407 WP_003113293.1.10457 WP_003113293.1.10468 WP_003113293.1.10477 WP_003113293.1.10482 WP_003113293.1.10572 WP_003113293.1.10636 WP_003113293.1.10641 WP_003113293.1.10684 WP_003113293.1.10764 WP_003113293.1.10856 WP_003113293.1.10901 WP_003113293.1.10949 WP_003113293.1.11026 WP_003113293.1.1107 WP_003113293.1.11077 WP_003113293.1.1109 WP_003113293.1.11163 WP_003113293.1.11178 WP_003113293.1.11381 WP_003113293.1.11388 WP_003113293.1.11568 WP_003113293.1.11653 WP_003113293.1.11744 WP_003113293.1.1180 WP_003113293.1.11847 WP_003113293.1.11943 WP_003113293.1.12018 WP_003113293.1.12120 WP_003113293.1.12200 WP_003113293.1.12208 WP_003113293.1.12240 WP_003113293.1.12482 WP_003113293.1.12530 WP_003113293.1.12561 WP_003113293.1.12657 WP_003113293.1.12670 WP_003113293.1.12838 WP_003113293.1.12873 WP_003113293.1.12891 WP_003113293.1.12930 WP_003113293.1.12934 WP_003113293.1.12970 WP_003113293.1.13 WP_003113293.1.1305 WP_003113293.1.13057 WP_003113293.1.13092 WP_003113293.1.13208 WP_003113293.1.13232 WP_003113293.1.13242 WP_003113293.1.13266 WP_003113293.1.13315 WP_003113293.1.1333 WP_003113293.1.13407 WP_003113293.1.1356 WP_003113293.1.1362 WP_003113293.1.13622 WP_003113293.1.13758 WP_003113293.1.13765 WP_003113293.1.13785 WP_003113293.1.13828 WP_003113293.1.13865 WP_003113293.1.1393 WP_003113293.1.14049 WP_003113293.1.14078 WP_003113293.1.14204 WP_003113293.1.14460 WP_003113293.1.14463 WP_003113293.1.14476 WP_003113293.1.14714 WP_003113293.1.1475 WP_003113293.1.14797 WP_003113293.1.14820 WP_003113293.1.14835 WP_003113293.1.14839 WP_003113293.1.14981 WP_003113293.1.1516 WP_003113293.1.152 WP_003113293.1.15281 WP_003113293.1.15297 WP_003113293.1.15328 WP_003113293.1.15373 WP_003113293.1.15474 WP_003113293.1.15480 WP_003113293.1.15482 WP_003113293.1.15485 WP_003113293.1.15602 WP_003113293.1.15889 WP_003113293.1.16074 WP_003113293.1.16109 WP_003113293.1.16161 WP_003113293.1.16197 WP_003113293.1.16267 WP_003113293.1.16660 WP_003113293.1.1671 WP_003113293.1.16782 WP_003113293.1.16895 WP_003113293.1.17022 WP_003113293.1.1704 WP_003113293.1.17162 WP_003113293.1.17354 WP_003113293.1.1739 WP_003113293.1.17397 WP_003113293.1.17566 WP_003113293.1.1758 WP_003113293.1.1761 WP_003113293.1.17697 WP_003113293.1.17883 WP_003113293.1.17890 WP_003113293.1.18052 WP_003113293.1.18054 WP_003113293.1.18199 WP_003113293.1.18204 WP_003113293.1.18234 WP_003113293.1.1824 WP_003113293.1.18493 WP_003113293.1.18547 WP_003113293.1.18653 WP_003113293.1.18728 WP_003113293.1.18769 WP_003113293.1.18795 WP_003113293.1.18852 WP_003113293.1.18911 WP_003113293.1.190 WP_003113293.1.19269 WP_003113293.1.19346 WP_003113293.1.19376 WP_003113293.1.1938 WP_003113293.1.19591 WP_003113293.1.19703 WP_003113293.1.19741 WP_003113293.1.19771 WP_003113293.1.19930 WP_003113293.1.19931 WP_003113293.1.20070 WP_003113293.1.20125 WP_003113293.1.20134 WP_003113293.1.20216 WP_003113293.1.20744 WP_003113293.1.20764 WP_003113293.1.20854 WP_003113293.1.20884 WP_003113293.1.209 WP_003113293.1.21039 WP_003113293.1.21100 WP_003113293.1.21166 WP_003113293.1.21209 WP_003113293.1.21242 WP_003113293.1.21253 WP_003113293.1.21302 WP_003113293.1.21349 WP_003113293.1.2144 WP_003113293.1.21448 WP_003113293.1.21460 WP_003113293.1.21517 WP_003113293.1.21607 WP_003113293.1.21718 WP_003113293.1.2172 WP_003113293.1.21744 WP_003113293.1.21767 WP_003113293.1.21932 WP_003113293.1.22078 WP_003113293.1.22365 WP_003113293.1.22390 WP_003113293.1.22394 WP_003113293.1.22442 WP_003113293.1.22671 WP_003113293.1.22704 WP_003113293.1.22863 WP_003113293.1.2289 WP_003113293.1.22891 WP_003113293.1.23195 WP_003113293.1.2323 WP_003113293.1.23418 WP_003113293.1.23512 WP_003113293.1.2355 WP_003113293.1.23581 WP_003113293.1.236 WP_003113293.1.23611 WP_003113293.1.23641 WP_003113293.1.23715 WP_003113293.1.23739 WP_003113293.1.2374 WP_003113293.1.23769 WP_003113293.1.23782 WP_003113293.1.23794 WP_003113293.1.23884 WP_003113293.1.23925 WP_003113293.1.23938 WP_003113293.1.23961 WP_003113293.1.23967 WP_003113293.1.23983 WP_003113293.1.24066 WP_003113293.1.24101 WP_003113293.1.24319 WP_003113293.1.24351 WP_003113293.1.24382 WP_003113293.1.24447 WP_003113293.1.24662 WP_003113293.1.2477 WP_003113293.1.24851 WP_003113293.1.24862 WP_003113293.1.24869 WP_003113293.1.24879 WP_003113293.1.24940 WP_003113293.1.25052 WP_003113293.1.251 WP_003113293.1.25109 WP_003113293.1.25142 WP_003113293.1.25149 WP_003113293.1.25271 WP_003113293.1.25328 WP_003113293.1.25344 WP_003113293.1.25348 WP_003113293.1.2535 WP_003113293.1.25532 WP_003113293.1.25600 WP_003113293.1.25695 WP_003113293.1.2572 WP_003113293.1.25903 WP_003113293.1.2596 WP_003113293.1.25964 WP_003113293.1.26010 WP_003113293.1.26042 WP_003113293.1.261 WP_003113293.1.26334 WP_003113293.1.26428 WP_003113293.1.26463 WP_003113293.1.26473 WP_003113293.1.26489 WP_003113293.1.2652 WP_003113293.1.26539 WP_003113293.1.26553 WP_003113293.1.26592 WP_003113293.1.26604 WP_003113293.1.26681 WP_003113293.1.26705 WP_003113293.1.26862 WP_003113293.1.2698 WP_003113293.1.27018 WP_003113293.1.27073 WP_003113293.1.27107 WP_003113293.1.27218 WP_003113293.1.27505 WP_003113293.1.27534 WP_003113293.1.27575 WP_003113293.1.27687 WP_003113293.1.27738 WP_003113293.1.27825 WP_003113293.1.27837 WP_003113293.1.27858 WP_003113293.1.27933 WP_003113293.1.27966 WP_003113293.1.28006 WP_003113293.1.28057 WP_003113293.1.28064 WP_003113293.1.28136 WP_003113293.1.28175 WP_003113293.1.28193 WP_003113293.1.28258 WP_003113293.1.283 WP_003113293.1.28316 WP_003113293.1.28329 WP_003113293.1.28372 WP_003113293.1.28383 WP_003113293.1.28404 WP_003113293.1.28468 WP_003113293.1.28560 WP_003113293.1.28623 WP_003113293.1.28699 WP_003113293.1.28800 WP_003113293.1.28823 WP_003113293.1.28849 WP_003113293.1.29062 WP_003113293.1.29096 WP_003113293.1.29127 WP_003113293.1.29158 WP_003113293.1.29179 WP_003113293.1.29208 WP_003113293.1.29401 WP_003113293.1.29438 WP_003113293.1.29440 WP_003113293.1.2948 WP_003113293.1.29481 WP_003113293.1.29498 WP_003113293.1.29501 WP_003113293.1.29577 WP_003113293.1.29633 WP_003113293.1.29668 WP_003113293.1.2980 WP_003113293.1.29958 WP_003113293.1.29973 WP_003113293.1.30081 WP_003113293.1.30120 WP_003113293.1.30254 WP_003113293.1.30365 WP_003113293.1.30474 WP_003113293.1.30567 WP_003113293.1.30707 WP_003113293.1.30740 WP_003113293.1.30797 WP_003113293.1.30815 WP_003113293.1.30886 WP_003113293.1.31076 WP_003113293.1.31087 WP_003113293.1.31105 WP_003113293.1.31138 WP_003113293.1.31147 WP_003113293.1.31279 WP_003113293.1.31565 WP_003113293.1.3172 WP_003113293.1.31732 WP_003113293.1.31741 WP_003113293.1.31852 WP_003113293.1.31939 WP_003113293.1.32137 WP_003113293.1.32289 WP_003113293.1.32314 WP_003113293.1.32523 WP_003113293.1.32544 WP_003113293.1.32711 WP_003113293.1.32821 WP_003113293.1.32879 WP_003113293.1.32998 WP_003113293.1.33009 WP_003113293.1.33133 WP_003113293.1.33152 WP_003113293.1.33186 WP_003113293.1.33204 WP_003113293.1.33210 WP_003113293.1.33216 WP_003113293.1.33387 WP_003113293.1.33441 WP_003113293.1.33455 WP_003113293.1.3351 WP_003113293.1.33517 WP_003113293.1.33521 WP_003113293.1.33547 WP_003113293.1.33658 WP_003113293.1.33733 WP_003113293.1.33734 WP_003113293.1.33774 WP_003113293.1.33801 WP_003113293.1.33824 WP_003113293.1.3385 WP_003113293.1.34000 WP_003113293.1.34039 WP_003113293.1.34151 WP_003113293.1.34203 WP_003113293.1.34306 WP_003113293.1.34324 WP_003113293.1.34401 WP_003113293.1.34402 WP_003113293.1.34461 WP_003113293.1.34465 WP_003113293.1.3452 WP_003113293.1.34568 WP_003113293.1.34583 WP_003113293.1.34625 WP_003113293.1.34689 WP_003113293.1.34832 WP_003113293.1.34837 WP_003113293.1.34876 WP_003113293.1.34901 WP_003113293.1.34922 WP_003113293.1.34942 WP_003113293.1.35036 WP_003113293.1.35104 WP_003113293.1.35231 WP_003113293.1.35281 WP_003113293.1.35353 WP_003113293.1.3540 WP_003113293.1.35431 WP_003113293.1.35480 WP_003113293.1.35512 WP_003113293.1.35573 WP_003113293.1.35669 WP_003113293.1.35679 WP_003113293.1.3568 WP_003113293.1.35682 WP_003113293.1.3576 WP_003113293.1.35768 WP_003113293.1.35822 WP_003113293.1.35843 WP_003113293.1.35857 WP_003113293.1.35872 WP_003113293.1.36170 WP_003113293.1.36378 WP_003113293.1.36435 WP_003113293.1.36487 WP_003113293.1.36521 WP_003113293.1.36587 WP_003113293.1.36608 WP_003113293.1.3662 WP_003113293.1.36630 WP_003113293.1.36665 WP_003113293.1.36708 WP_003113293.1.36756 WP_003113293.1.36781 WP_003113293.1.36879 WP_003113293.1.37050 WP_003113293.1.37125 WP_003113293.1.37163 WP_003113293.1.37172 WP_003113293.1.3721 WP_003113293.1.37216 WP_003113293.1.37319 WP_003113293.1.37366 WP_003113293.1.37416 WP_003113293.1.37512 WP_003113293.1.37698 WP_003113293.1.37703 WP_003113293.1.3773 WP_003113293.1.37814 WP_003113293.1.37826 WP_003113293.1.37842 WP_003113293.1.3785 WP_003113293.1.38003 WP_003113293.1.38102 WP_003113293.1.38146 WP_003113293.1.38151 WP_003113293.1.38186 WP_003113293.1.38319 WP_003113293.1.3833 WP_003113293.1.38406 WP_003113293.1.38430 WP_003113293.1.38502 WP_003113293.1.38582 WP_003113293.1.38583 WP_003113293.1.38657 WP_003113293.1.38661 WP_003113293.1.38706 WP_003113293.1.38727 WP_003113293.1.38834 WP_003113293.1.38889 WP_003113293.1.38932 WP_003113293.1.39046 WP_003113293.1.39088 WP_003113293.1.39122 WP_003113293.1.39186 WP_003113293.1.39271 WP_003113293.1.3943 WP_003113293.1.39444 WP_003113293.1.39704 WP_003113293.1.39786 WP_003113293.1.40059 WP_003113293.1.40115 WP_003113293.1.40213 WP_003113293.1.40237 WP_003113293.1.40243 WP_003113293.1.40512 WP_003113293.1.40513 WP_003113293.1.40546 WP_003113293.1.40595 WP_003113293.1.40703 WP_003113293.1.40994 WP_003113293.1.41290 WP_003113293.1.41301 WP_003113293.1.41384 WP_003113293.1.41492 WP_003113293.1.41502 WP_003113293.1.41624 WP_003113293.1.41625 WP_003113293.1.41703 WP_003113293.1.41725 WP_003113293.1.41732 WP_003113293.1.41748 WP_003113293.1.41773 WP_003113293.1.41832 WP_003113293.1.41871 WP_003113293.1.41888 WP_003113293.1.4190 WP_003113293.1.41939 WP_003113293.1.4196 WP_003113293.1.42 WP_003113293.1.42041 WP_003113293.1.42047 WP_003113293.1.42146 WP_003113293.1.42259 WP_003113293.1.42294 WP_003113293.1.42381 WP_003113293.1.42388 WP_003113293.1.42411 WP_003113293.1.42423 WP_003113293.1.42643 WP_003113293.1.42696 WP_003113293.1.42754 WP_003113293.1.42757 WP_003113293.1.42778 WP_003113293.1.42972 WP_003113293.1.42973 WP_003113293.1.43022 WP_003113293.1.43024 WP_003113293.1.43026 WP_003113293.1.43107 WP_003113293.1.43245 WP_003113293.1.43293 WP_003113293.1.43315 WP_003113293.1.43330 WP_003113293.1.4348 WP_003113293.1.43662 WP_003113293.1.43667 WP_003113293.1.43696 WP_003113293.1.43802 WP_003113293.1.43811 WP_003113293.1.43826 WP_003113293.1.4398 WP_003113293.1.44094 WP_003113293.1.44213 WP_003113293.1.44260 WP_003113293.1.44373 WP_003113293.1.44563 WP_003113293.1.44581 WP_003113293.1.44739 WP_003113293.1.44760 WP_003113293.1.4493 WP_003113293.1.44959 WP_003113293.1.45063 WP_003113293.1.45090 WP_003113293.1.45146 WP_003113293.1.45199 WP_003113293.1.45202 WP_003113293.1.45228 WP_003113293.1.45312 WP_003113293.1.4532 WP_003113293.1.45328 WP_003113293.1.45353 WP_003113293.1.45464 WP_003113293.1.45478 WP_003113293.1.45485 WP_003113293.1.45635 WP_003113293.1.45636 WP_003113293.1.45678 WP_003113293.1.45711 WP_003113293.1.45934 WP_003113293.1.45961 WP_003113293.1.46032 WP_003113293.1.461 WP_003113293.1.46152 WP_003113293.1.46436 WP_003113293.1.46502 WP_003113293.1.46755 WP_003113293.1.46846 WP_003113293.1.46885 WP_003113293.1.46926 WP_003113293.1.46935 WP_003113293.1.47101 WP_003113293.1.47150 WP_003113293.1.47155 WP_003113293.1.47251 WP_003113293.1.47296 WP_003113293.1.47480 WP_003113293.1.47598 WP_003113293.1.47645 WP_003113293.1.47774 WP_003113293.1.47970 WP_003113293.1.48001 WP_003113293.1.48024 WP_003113293.1.48086 WP_003113293.1.48094 WP_003113293.1.48172 WP_003113293.1.48321 WP_003113293.1.48334 WP_003113293.1.4836 WP_003113293.1.48378 WP_003113293.1.48487 WP_003113293.1.48545 WP_003113293.1.48810 WP_003113293.1.48842 WP_003113293.1.48870 WP_003113293.1.48961 WP_003113293.1.4913 WP_003113293.1.49244 WP_003113293.1.49265 WP_003113293.1.49266 WP_003113293.1.49277 WP_003113293.1.49286 WP_003113293.1.49416 WP_003113293.1.49557 WP_003113293.1.49688 WP_003113293.1.49798 WP_003113293.1.49833 WP_003113293.1.49842 WP_003113293.1.49922 WP_003113293.1.49976 WP_003113293.1.49998 WP_003113293.1.50176 WP_003113293.1.50222 WP_003113293.1.50232 WP_003113293.1.5043 WP_003113293.1.50459 WP_003113293.1.50567 WP_003113293.1.50653 WP_003113293.1.50668 WP_003113293.1.50682 WP_003113293.1.50734 WP_003113293.1.50783 WP_003113293.1.50922 WP_003113293.1.50967 WP_003113293.1.51019 WP_003113293.1.51173 WP_003113293.1.51183 WP_003113293.1.51267 WP_003113293.1.5132 WP_003113293.1.51457 WP_003113293.1.51472 WP_003113293.1.51538 WP_003113293.1.51549 WP_003113293.1.51585 WP_003113293.1.51682 WP_003113293.1.51807 WP_003113293.1.51847 WP_003113293.1.51928 WP_003113293.1.51976 WP_003113293.1.52152 WP_003113293.1.52212 WP_003113293.1.52220 WP_003113293.1.52244 WP_003113293.1.52334 WP_003113293.1.5235 WP_003113293.1.52449 WP_003113293.1.52537 WP_003113293.1.5258 WP_003113293.1.52583 WP_003113293.1.52690 WP_003113293.1.52697 WP_003113293.1.52700 WP_003113293.1.52784 WP_003113293.1.52790 WP_003113293.1.52810 WP_003113293.1.53038 WP_003113293.1.53267 WP_003113293.1.53351 WP_003113293.1.53371 WP_003113293.1.53414 WP_003113293.1.53486 WP_003113293.1.53530 WP_003113293.1.53719 WP_003113293.1.53726 WP_003113293.1.53826 WP_003113293.1.5388 WP_003113293.1.53932 WP_003113293.1.53948 WP_003113293.1.54003 WP_003113293.1.54078 WP_003113293.1.54090 WP_003113293.1.54146 WP_003113293.1.54248 WP_003113293.1.54354 WP_003113293.1.54462 WP_003113293.1.54571 WP_003113293.1.54742 WP_003113293.1.54809 WP_003113293.1.54974 WP_003113293.1.55089 WP_003113293.1.55169 WP_003113293.1.55445 WP_003113293.1.55478 WP_003113293.1.55543 WP_003113293.1.56013 WP_003113293.1.56145 WP_003113293.1.56171 WP_003113293.1.56188 WP_003113293.1.56229 WP_003113293.1.56315 WP_003113293.1.56348 WP_003113293.1.56745 WP_003113293.1.56768 WP_003113293.1.56797 WP_003113293.1.56808 WP_003113293.1.56819 WP_003113293.1.56973 WP_003113293.1.57005 WP_003113293.1.57113 WP_003113293.1.57131 WP_003113293.1.57140 WP_003113293.1.57276 WP_003113293.1.5731 WP_003113293.1.57339 WP_003113293.1.57417 WP_003113293.1.57460 WP_003113293.1.57480 WP_003113293.1.57548 WP_003113293.1.57566 WP_003113293.1.57839 WP_003113293.1.58019 WP_003113293.1.58056 WP_003113293.1.58155 WP_003113293.1.58162 WP_003113293.1.58183 WP_003113293.1.58193 WP_003113293.1.58294 WP_003113293.1.58482 WP_003113293.1.5856 WP_003113293.1.58689 WP_003113293.1.5869 WP_003113293.1.58785 WP_003113293.1.59013 WP_003113293.1.59076 WP_003113293.1.59156 WP_003113293.1.59176 WP_003113293.1.59250 WP_003113293.1.59288 WP_003113293.1.5937 WP_003113293.1.594 WP_003113293.1.59469 WP_003113293.1.59563 WP_003113293.1.59688 WP_003113293.1.59759 WP_003113293.1.59797 WP_003113293.1.59831 WP_003113293.1.59870 WP_003113293.1.60051 WP_003113293.1.60082 WP_003113293.1.60085 WP_003113293.1.60415 WP_003113293.1.60467 WP_003113293.1.60602 WP_003113293.1.60603 WP_003113293.1.60639 WP_003113293.1.60679 WP_003113293.1.60686 WP_003113293.1.607 WP_003113293.1.60910 WP_003113293.1.60916 WP_003113293.1.60970 WP_003113293.1.61130 WP_003113293.1.61191 WP_003113293.1.61209 WP_003113293.1.61288 WP_003113293.1.61299 WP_003113293.1.6130 WP_003113293.1.61366 WP_003113293.1.61598 WP_003113293.1.61696 WP_003113293.1.6173 WP_003113293.1.62186 WP_003113293.1.62211 WP_003113293.1.62357 WP_003113293.1.62396 WP_003113293.1.6242 WP_003113293.1.62483 WP_003113293.1.62516 WP_003113293.1.62534 WP_003113293.1.626 WP_003113293.1.62701 WP_003113293.1.62704 WP_003113293.1.62708 WP_003113293.1.62716 WP_003113293.1.62768 WP_003113293.1.6280 WP_003113293.1.6283 WP_003113293.1.62834 WP_003113293.1.62873 WP_003113293.1.62977 WP_003113293.1.63057 WP_003113293.1.63193 WP_003113293.1.63196 WP_003113293.1.63338 WP_003113293.1.63369 WP_003113293.1.63597 WP_003113293.1.63634 WP_003113293.1.63995 WP_003113293.1.64329 WP_003113293.1.64340 WP_003113293.1.6450 WP_003113293.1.64591 WP_003113293.1.64726 WP_003113293.1.64748 WP_003113293.1.64799 WP_003113293.1.64807 WP_003113293.1.64854 WP_003113293.1.64862 WP_003113293.1.64983 WP_003113293.1.64984 WP_003113293.1.65066 WP_003113293.1.65092 WP_003113293.1.65099 WP_003113293.1.65145 WP_003113293.1.65196 WP_003113293.1.65197 WP_003113293.1.65237 WP_003113293.1.65335 WP_003113293.1.65549 WP_003113293.1.65588 WP_003113293.1.65642 WP_003113293.1.65679 WP_003113293.1.65740 WP_003113293.1.65779 WP_003113293.1.65819 WP_003113293.1.6589 WP_003113293.1.65926 WP_003113293.1.66062 WP_003113293.1.66277 WP_003113293.1.66345 WP_003113293.1.66364 WP_003113293.1.66526 WP_003113293.1.66563 WP_003113293.1.66892 WP_003113293.1.66929 WP_003113293.1.66950 WP_003113293.1.67010 WP_003113293.1.67188 WP_003113293.1.67192 WP_003113293.1.67205 WP_003113293.1.67261 WP_003113293.1.6734 WP_003113293.1.67370 WP_003113293.1.67388 WP_003113293.1.67472 WP_003113293.1.67526 WP_003113293.1.6768 WP_003113293.1.67686 WP_003113293.1.67755 WP_003113293.1.67830 WP_003113293.1.67875 WP_003113293.1.67937 WP_003113293.1.67948 WP_003113293.1.68000 WP_003113293.1.6808 WP_003113293.1.68158 WP_003113293.1.68162 WP_003113293.1.68183 WP_003113293.1.68252 WP_003113293.1.68472 WP_003113293.1.6850 WP_003113293.1.68561 WP_003113293.1.68568 WP_003113293.1.68756 WP_003113293.1.68781 WP_003113293.1.68790 WP_003113293.1.68850 WP_003113293.1.68857 WP_003113293.1.68862 WP_003113293.1.68881 WP_003113293.1.68938 WP_003113293.1.69088 WP_003113293.1.69159 WP_003113293.1.69209 WP_003113293.1.69260 WP_003113293.1.6928 WP_003113293.1.6931 WP_003113293.1.6937 WP_003113293.1.69411 WP_003113293.1.69556 WP_003113293.1.69702 WP_003113293.1.69788 WP_003113293.1.69791 WP_003113293.1.69907 WP_003113293.1.69993 WP_003113293.1.70092 WP_003113293.1.70138 WP_003113293.1.70168 WP_003113293.1.70216 WP_003113293.1.70229 WP_003113293.1.70470 WP_003113293.1.70648 WP_003113293.1.70670 WP_003113293.1.7077 WP_003113293.1.70778 WP_003113293.1.70831 WP_003113293.1.70991 WP_003113293.1.71038 WP_003113293.1.71203 WP_003113293.1.71234 WP_003113293.1.71249 WP_003113293.1.7128 WP_003113293.1.71346 WP_003113293.1.71385 WP_003113293.1.71412 WP_003113293.1.71570 WP_003113293.1.71642 WP_003113293.1.71806 WP_003113293.1.71822 WP_003113293.1.71862 WP_003113293.1.71866 WP_003113293.1.71891 WP_003113293.1.72149 WP_003113293.1.72167 WP_003113293.1.72181 WP_003113293.1.72183 WP_003113293.1.72287 WP_003113293.1.72323 WP_003113293.1.72331 WP_003113293.1.72346 WP_003113293.1.72378 WP_003113293.1.72447 WP_003113293.1.72477 WP_003113293.1.72541 WP_003113293.1.72669 WP_003113293.1.7276 WP_003113293.1.72768 WP_003113293.1.72845 WP_003113293.1.73048 WP_003113293.1.73149 WP_003113293.1.73192 WP_003113293.1.7327 WP_003113293.1.7329 WP_003113293.1.733 WP_003113293.1.73455 WP_003113293.1.73523 WP_003113293.1.73541 WP_003113293.1.73601 WP_003113293.1.73719 WP_003113293.1.7382 WP_003113293.1.73889 WP_003113293.1.73911 WP_003113293.1.74000 WP_003113293.1.74074 WP_003113293.1.7408 WP_003113293.1.74106 WP_003113293.1.74167 WP_003113293.1.74219 WP_003113293.1.74264 WP_003113293.1.74287 WP_003113293.1.74458 WP_003113293.1.74473 WP_003113293.1.74475 WP_003113293.1.74568 WP_003113293.1.74629 WP_003113293.1.74637 WP_003113293.1.74772 WP_003113293.1.748 WP_003113293.1.74941 WP_003113293.1.74948 WP_003113293.1.75041 WP_003113293.1.75204 WP_003113293.1.75303 WP_003113293.1.7547 WP_003113293.1.75549 WP_003113293.1.75573 WP_003113293.1.75599 WP_003113293.1.75631 WP_003113293.1.75825 WP_003113293.1.75860 WP_003113293.1.75938 WP_003113293.1.7595 WP_003113293.1.76092 WP_003113293.1.76355 WP_003113293.1.76399 WP_003113293.1.76484 WP_003113293.1.76543 WP_003113293.1.76600 WP_003113293.1.76633 WP_003113293.1.7666 WP_003113293.1.76716 WP_003113293.1.76922 WP_003113293.1.77235 WP_003113293.1.77286 WP_003113293.1.77317 WP_003113293.1.77476 WP_003113293.1.77490 WP_003113293.1.77574 WP_003113293.1.77686 WP_003113293.1.77750 WP_003113293.1.77769 WP_003113293.1.77819 WP_003113293.1.78104 WP_003113293.1.78112 WP_003113293.1.78148 WP_003113293.1.78280 WP_003113293.1.78380 WP_003113293.1.7840 WP_003113293.1.78409 WP_003113293.1.78425 WP_003113293.1.78430 WP_003113293.1.78570 WP_003113293.1.78623 WP_003113293.1.78669 WP_003113293.1.78810 WP_003113293.1.78926 WP_003113293.1.78947 WP_003113293.1.7899 WP_003113293.1.79007 WP_003113293.1.79053 WP_003113293.1.79177 WP_003113293.1.79193 WP_003113293.1.79279 WP_003113293.1.79286 WP_003113293.1.79311 WP_003113293.1.79357 WP_003113293.1.79364 WP_003113293.1.79421 WP_003113293.1.79429 WP_003113293.1.79431 WP_003113293.1.7945 WP_003113293.1.79463 WP_003113293.1.79507 WP_003113293.1.7953 WP_003113293.1.79569 WP_003113293.1.79699 WP_003113293.1.79788 WP_003113293.1.79883 WP_003113293.1.79902 WP_003113293.1.8 WP_003113293.1.80033 WP_003113293.1.80068 WP_003113293.1.8013 WP_003113293.1.80258 WP_003113293.1.80306 WP_003113293.1.80410 WP_003113293.1.80454 WP_003113293.1.80481 WP_003113293.1.8051 WP_003113293.1.80535 WP_003113293.1.80572 WP_003113293.1.80627 WP_003113293.1.80632 WP_003113293.1.8064 WP_003113293.1.80644 WP_003113293.1.80892 WP_003113293.1.80929 WP_003113293.1.80938 WP_003113293.1.80969 WP_003113293.1.81082 WP_003113293.1.81206 WP_003113293.1.81237 WP_003113293.1.81380 WP_003113293.1.81482 WP_003113293.1.81487 WP_003113293.1.81622 WP_003113293.1.81708 WP_003113293.1.81742 WP_003113293.1.81748 WP_003113293.1.81771 WP_003113293.1.81802 WP_003113293.1.81844 WP_003113293.1.81950 WP_003113293.1.81986 WP_003113293.1.82117 WP_003113293.1.82127 WP_003113293.1.82178 WP_003113293.1.82260 WP_003113293.1.8227 WP_003113293.1.82310 WP_003113293.1.82312 WP_003113293.1.8238 WP_003113293.1.82442 WP_003113293.1.82487 WP_003113293.1.82580 WP_003113293.1.82606 WP_003113293.1.82620 WP_003113293.1.82643 WP_003113293.1.82686 WP_003113293.1.82710 WP_003113293.1.82887 WP_003113293.1.82936 WP_003113293.1.83025 WP_003113293.1.83184 WP_003113293.1.83251 WP_003113293.1.83296 WP_003113293.1.83317 WP_003113293.1.83394 WP_003113293.1.83463 WP_003113293.1.835 WP_003113293.1.8353 WP_003113293.1.8357 WP_003113293.1.83637 WP_003113293.1.83673 WP_003113293.1.83946 WP_003113293.1.84008 WP_003113293.1.84138 WP_003113293.1.84162 WP_003113293.1.84177 WP_003113293.1.84190 WP_003113293.1.84271 WP_003113293.1.84297 WP_003113293.1.84374 WP_003113293.1.84398 WP_003113293.1.84526 WP_003113293.1.8453 WP_003113293.1.84589 WP_003113293.1.84674 WP_003113293.1.84684 WP_003113293.1.84702 WP_003113293.1.84715 WP_003113293.1.84754 WP_003113293.1.84792 WP_003113293.1.84865 WP_003113293.1.85028 WP_003113293.1.85220 WP_003113293.1.85290 WP_003113293.1.85298 WP_003113293.1.85303 WP_003113293.1.85318 WP_003113293.1.85357 WP_003113293.1.85446 WP_003113293.1.85453 WP_003113293.1.85897 WP_003113293.1.85910 WP_003113293.1.86002 WP_003113293.1.86047 WP_003113293.1.86055 WP_003113293.1.86058 WP_003113293.1.86125 WP_003113293.1.86182 WP_003113293.1.86278 WP_003113293.1.86293 WP_003113293.1.865 WP_003113293.1.86545 WP_003113293.1.86552 WP_003113293.1.86774 WP_003113293.1.86780 WP_003113293.1.86985 WP_003113293.1.87163 WP_003113293.1.8718 WP_003113293.1.87182 WP_003113293.1.87183 WP_003113293.1.87316 WP_003113293.1.87390 WP_003113293.1.87435 WP_003113293.1.87463 WP_003113293.1.87530 WP_003113293.1.87648 WP_003113293.1.87763 WP_003113293.1.8777 WP_003113293.1.87877 WP_003113293.1.87981 WP_003113293.1.87987 WP_003113293.1.88004 WP_003113293.1.88360 WP_003113293.1.88415 WP_003113293.1.8852 WP_003113293.1.88550 WP_003113293.1.88578 WP_003113293.1.88605 WP_003113293.1.88659 WP_003113293.1.88680 WP_003113293.1.88714 WP_003113293.1.889 WP_003113293.1.88969 WP_003113293.1.89083 WP_003113293.1.89098 WP_003113293.1.89245 WP_003113293.1.89276 WP_003113293.1.89409 WP_003113293.1.89577 WP_003113293.1.89610 WP_003113293.1.89662 WP_003113293.1.89736 WP_003113293.1.89805 WP_003113293.1.89866 WP_003113293.1.89867 WP_003113293.1.89886 WP_003113293.1.90056 WP_003113293.1.90110 WP_003113293.1.90141 WP_003113293.1.90150 WP_003113293.1.90189 WP_003113293.1.90225 WP_003113293.1.90242 WP_003113293.1.90268 WP_003113293.1.90306 WP_003113293.1.90412 WP_003113293.1.9056 WP_003113293.1.90569 WP_003113293.1.90999 WP_003113293.1.91093 WP_003113293.1.91161 WP_003113293.1.9120 WP_003113293.1.91281 WP_003113293.1.91336 WP_003113293.1.9143 WP_003113293.1.91431 WP_003113293.1.91585 WP_003113293.1.91796 WP_003113293.1.9182 WP_003113293.1.91838 WP_003113293.1.91846 WP_003113293.1.91860 WP_003113293.1.91862 WP_003113293.1.91943 WP_003113293.1.92175 WP_003113293.1.9219 WP_003113293.1.92314 WP_003113293.1.92357 WP_003113293.1.92573 WP_003113293.1.92585 WP_003113293.1.92589 WP_003113293.1.92594 WP_003113293.1.92624 WP_003113293.1.92642 WP_003113293.1.92769 WP_003113293.1.92847 WP_003113293.1.92924 WP_003113293.1.93001 WP_003113293.1.93122 WP_003113293.1.93130 WP_003113293.1.9328 WP_003113293.1.93493 WP_003113293.1.93498 WP_003113293.1.93547 WP_003113293.1.93562 WP_003113293.1.93797 WP_003113293.1.94004 WP_003113293.1.94031 WP_003113293.1.94065 WP_003113293.1.94136 WP_003113293.1.94174 WP_003113293.1.94211 WP_003113293.1.94218 WP_003113293.1.94243 WP_003113293.1.94385 WP_003113293.1.94434 WP_003113293.1.94450 WP_003113293.1.94682 WP_003113293.1.94732 WP_003113293.1.94742 WP_003113293.1.94818 WP_003113293.1.94856 WP_003113293.1.94874 WP_003113293.1.94897 WP_003113293.1.95025 WP_003113293.1.95027 WP_003113293.1.95117 WP_003113293.1.95187 WP_003113293.1.95207 WP_003113293.1.95354 WP_003113293.1.95359 WP_003113293.1.95460 WP_003113293.1.95525 WP_003113293.1.95536 WP_003113293.1.95638 WP_003113293.1.95668 WP_003113293.1.95774 WP_003113293.1.95802 WP_003113293.1.95820 WP_003113293.1.95825 WP_003113293.1.9599 WP_003113293.1.95994 WP_003113293.1.96041 WP_003113293.1.96193 WP_003113293.1.96243 WP_003113293.1.96267 WP_003113293.1.96384 WP_003113293.1.96434 WP_003113293.1.96452 WP_003113293.1.96702 WP_003113293.1.96714 WP_003113293.1.96967 WP_003113293.1.9706 WP_003113293.1.97118 WP_003113293.1.97204 WP_003113293.1.97213 WP_003113293.1.9722 WP_003113293.1.97271 WP_003113293.1.97272 WP_003113293.1.97377 WP_003113293.1.97461 WP_003113293.1.97474 WP_003113293.1.97499 WP_003113293.1.97521 WP_003113293.1.97583 WP_003113293.1.97614 WP_003113293.1.977 WP_003113293.1.97826 WP_003113293.1.97968 WP_003113293.1.98260 WP_003113293.1.98276 WP_003113293.1.98410 WP_003113293.1.98414 WP_003113293.1.98433 WP_003113293.1.98515 WP_003113293.1.98522 WP_003113293.1.98573 WP_003113293.1.98600 WP_003113293.1.98610 WP_003113293.1.98678 WP_003113293.1.98788 WP_003113293.1.98907 WP_003113293.1.98926 WP_003113293.1.99068 WP_003113293.1.99103 WP_003113293.1.99293 WP_003113293.1.99353 WP_003113293.1.99389 WP_003113293.1.99516 WP_003113293.1.99654 WP_003113293.1.99662 WP_003113293.1.99746 WP_003113293.1.99757 WP_003113293.1.99795 WP_003113293.1.9989 gi|15597669|ref|NP_251163.1| gi|568153976|ref|YP_008942954.1| 208964.PA2473 557722.PLES_28231 gi|218891547|ref|YP_002440414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]