SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154387|ref|YP_008943368.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154387|ref|YP_008943368.1|
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Putative cyclase 7.98e-60
Family Putative cyclase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568154387|ref|YP_008943368.1|
Sequence length 213
Comment kynurenine formamidase [Pseudomonas aeruginosa LES431]
Sequence
MTSLRYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLH
YRADGLPIGQVPLDVYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANW
PEGFCAIAPATIECLAERGVRLVGIDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDV
PAGDYELLALPLKFTHLDASPVRAVLRALPTAE
Download sequence
Identical sequences A0A0F6UDK3 A0A1S1C7N7 V6AGM1
gi|478479131|ref|YP_007709782.1| gi|386059025|ref|YP_005975547.1| gi|218891962|ref|YP_002440829.1| WP_003088775.1.100100 WP_003088775.1.100179 WP_003088775.1.100394 WP_003088775.1.100469 WP_003088775.1.100473 WP_003088775.1.100723 WP_003088775.1.100777 WP_003088775.1.100809 WP_003088775.1.101021 WP_003088775.1.101590 WP_003088775.1.101642 WP_003088775.1.10174 WP_003088775.1.101781 WP_003088775.1.101871 WP_003088775.1.10202 WP_003088775.1.10204 WP_003088775.1.10228 WP_003088775.1.1037 WP_003088775.1.10407 WP_003088775.1.10419 WP_003088775.1.10435 WP_003088775.1.10856 WP_003088775.1.10949 WP_003088775.1.11026 WP_003088775.1.11130 WP_003088775.1.11163 WP_003088775.1.11388 WP_003088775.1.11754 WP_003088775.1.1183 WP_003088775.1.11943 WP_003088775.1.12081 WP_003088775.1.12302 WP_003088775.1.1238 WP_003088775.1.12657 WP_003088775.1.12660 WP_003088775.1.12890 WP_003088775.1.12891 WP_003088775.1.13077 WP_003088775.1.13232 WP_003088775.1.13242 WP_003088775.1.1333 WP_003088775.1.13364 WP_003088775.1.13407 WP_003088775.1.13642 WP_003088775.1.13758 WP_003088775.1.13865 WP_003088775.1.14049 WP_003088775.1.14116 WP_003088775.1.14378 WP_003088775.1.14463 WP_003088775.1.14476 WP_003088775.1.14640 WP_003088775.1.14679 WP_003088775.1.14690 WP_003088775.1.14714 WP_003088775.1.1475 WP_003088775.1.15004 WP_003088775.1.15130 WP_003088775.1.152 WP_003088775.1.15231 WP_003088775.1.15297 WP_003088775.1.15328 WP_003088775.1.15408 WP_003088775.1.15666 WP_003088775.1.15886 WP_003088775.1.15934 WP_003088775.1.16074 WP_003088775.1.16242 WP_003088775.1.16279 WP_003088775.1.16419 WP_003088775.1.1646 WP_003088775.1.16660 WP_003088775.1.16788 WP_003088775.1.16801 WP_003088775.1.17155 WP_003088775.1.17189 WP_003088775.1.17397 WP_003088775.1.17499 WP_003088775.1.18732 WP_003088775.1.18735 WP_003088775.1.18911 WP_003088775.1.18930 WP_003088775.1.19269 WP_003088775.1.19346 WP_003088775.1.1938 WP_003088775.1.19711 WP_003088775.1.19930 WP_003088775.1.20216 WP_003088775.1.20342 WP_003088775.1.20590 WP_003088775.1.20682 WP_003088775.1.20929 WP_003088775.1.21002 WP_003088775.1.21100 WP_003088775.1.21166 WP_003088775.1.21302 WP_003088775.1.2144 WP_003088775.1.21517 WP_003088775.1.21718 WP_003088775.1.21744 WP_003088775.1.21871 WP_003088775.1.21891 WP_003088775.1.221 WP_003088775.1.2237 WP_003088775.1.22477 WP_003088775.1.22573 WP_003088775.1.22671 WP_003088775.1.22704 WP_003088775.1.22863 WP_003088775.1.23013 WP_003088775.1.23191 WP_003088775.1.23195 WP_003088775.1.236 WP_003088775.1.23715 WP_003088775.1.2374 WP_003088775.1.24077 WP_003088775.1.24087 WP_003088775.1.24351 WP_003088775.1.24382 WP_003088775.1.2453 WP_003088775.1.24626 WP_003088775.1.24869 WP_003088775.1.24938 WP_003088775.1.25033 WP_003088775.1.251 WP_003088775.1.25142 WP_003088775.1.25328 WP_003088775.1.25344 WP_003088775.1.2535 WP_003088775.1.25600 WP_003088775.1.25641 WP_003088775.1.25695 WP_003088775.1.25903 WP_003088775.1.26463 WP_003088775.1.26682 WP_003088775.1.26816 WP_003088775.1.27073 WP_003088775.1.27107 WP_003088775.1.27211 WP_003088775.1.27259 WP_003088775.1.27549 WP_003088775.1.27575 WP_003088775.1.27587 WP_003088775.1.27837 WP_003088775.1.27939 WP_003088775.1.28193 WP_003088775.1.283 WP_003088775.1.28316 WP_003088775.1.28560 WP_003088775.1.28713 WP_003088775.1.28878 WP_003088775.1.28920 WP_003088775.1.29008 WP_003088775.1.29070 WP_003088775.1.29137 WP_003088775.1.29158 WP_003088775.1.2927 WP_003088775.1.2941 WP_003088775.1.29472 WP_003088775.1.29481 WP_003088775.1.29577 WP_003088775.1.29650 WP_003088775.1.29668 WP_003088775.1.30000 WP_003088775.1.30020 WP_003088775.1.30081 WP_003088775.1.3030 WP_003088775.1.30474 WP_003088775.1.30693 WP_003088775.1.30740 WP_003088775.1.30797 WP_003088775.1.30815 WP_003088775.1.30842 WP_003088775.1.30994 WP_003088775.1.31045 WP_003088775.1.31279 WP_003088775.1.31565 WP_003088775.1.31633 WP_003088775.1.31751 WP_003088775.1.31848 WP_003088775.1.31939 WP_003088775.1.32134 WP_003088775.1.32235 WP_003088775.1.32289 WP_003088775.1.32523 WP_003088775.1.32544 WP_003088775.1.32596 WP_003088775.1.32626 WP_003088775.1.32637 WP_003088775.1.32869 WP_003088775.1.33210 WP_003088775.1.33340 WP_003088775.1.33441 WP_003088775.1.33728 WP_003088775.1.33801 WP_003088775.1.33822 WP_003088775.1.33824 WP_003088775.1.33945 WP_003088775.1.34150 WP_003088775.1.34317 WP_003088775.1.34324 WP_003088775.1.34465 WP_003088775.1.34625 WP_003088775.1.34670 WP_003088775.1.34689 WP_003088775.1.34832 WP_003088775.1.34878 WP_003088775.1.34901 WP_003088775.1.34922 WP_003088775.1.34942 WP_003088775.1.35149 WP_003088775.1.35325 WP_003088775.1.35353 WP_003088775.1.3540 WP_003088775.1.35512 WP_003088775.1.35529 WP_003088775.1.3555 WP_003088775.1.35599 WP_003088775.1.3568 WP_003088775.1.35762 WP_003088775.1.35857 WP_003088775.1.35984 WP_003088775.1.36148 WP_003088775.1.36285 WP_003088775.1.36487 WP_003088775.1.3653 WP_003088775.1.36608 WP_003088775.1.3662 WP_003088775.1.36781 WP_003088775.1.37050 WP_003088775.1.3742 WP_003088775.1.3773 WP_003088775.1.38003 WP_003088775.1.38102 WP_003088775.1.3833 WP_003088775.1.38335 WP_003088775.1.38337 WP_003088775.1.38406 WP_003088775.1.38450 WP_003088775.1.38502 WP_003088775.1.38505 WP_003088775.1.38727 WP_003088775.1.38834 WP_003088775.1.38971 WP_003088775.1.39088 WP_003088775.1.39345 WP_003088775.1.3943 WP_003088775.1.39458 WP_003088775.1.39811 WP_003088775.1.39920 WP_003088775.1.3998 WP_003088775.1.40271 WP_003088775.1.40513 WP_003088775.1.40595 WP_003088775.1.40703 WP_003088775.1.41137 WP_003088775.1.41199 WP_003088775.1.41291 WP_003088775.1.41412 WP_003088775.1.41487 WP_003088775.1.41492 WP_003088775.1.4156 WP_003088775.1.41618 WP_003088775.1.41624 WP_003088775.1.41625 WP_003088775.1.41939 WP_003088775.1.42047 WP_003088775.1.42259 WP_003088775.1.42463 WP_003088775.1.42508 WP_003088775.1.42634 WP_003088775.1.42696 WP_003088775.1.42723 WP_003088775.1.4273 WP_003088775.1.42854 WP_003088775.1.42946 WP_003088775.1.42952 WP_003088775.1.43212 WP_003088775.1.43326 WP_003088775.1.43330 WP_003088775.1.43356 WP_003088775.1.43662 WP_003088775.1.43667 WP_003088775.1.43673 WP_003088775.1.4381 WP_003088775.1.43811 WP_003088775.1.44213 WP_003088775.1.44269 WP_003088775.1.445 WP_003088775.1.44552 WP_003088775.1.44563 WP_003088775.1.44804 WP_003088775.1.44870 WP_003088775.1.44959 WP_003088775.1.45090 WP_003088775.1.45306 WP_003088775.1.4532 WP_003088775.1.45358 WP_003088775.1.45485 WP_003088775.1.45611 WP_003088775.1.45723 WP_003088775.1.45934 WP_003088775.1.45946 WP_003088775.1.45961 WP_003088775.1.46010 WP_003088775.1.46152 WP_003088775.1.4640 WP_003088775.1.46623 WP_003088775.1.46846 WP_003088775.1.4699 WP_003088775.1.47150 WP_003088775.1.47158 WP_003088775.1.47251 WP_003088775.1.47527 WP_003088775.1.47551 WP_003088775.1.47598 WP_003088775.1.47774 WP_003088775.1.47930 WP_003088775.1.48024 WP_003088775.1.48382 WP_003088775.1.48576 WP_003088775.1.48579 WP_003088775.1.48840 WP_003088775.1.48870 WP_003088775.1.48961 WP_003088775.1.49277 WP_003088775.1.49293 WP_003088775.1.49500 WP_003088775.1.49922 WP_003088775.1.49988 WP_003088775.1.50232 WP_003088775.1.50450 WP_003088775.1.50665 WP_003088775.1.51035 WP_003088775.1.51183 WP_003088775.1.51267 WP_003088775.1.51273 WP_003088775.1.5132 WP_003088775.1.51472 WP_003088775.1.52043 WP_003088775.1.52146 WP_003088775.1.52152 WP_003088775.1.52244 WP_003088775.1.5226 WP_003088775.1.5235 WP_003088775.1.52372 WP_003088775.1.52403 WP_003088775.1.52409 WP_003088775.1.52449 WP_003088775.1.52591 WP_003088775.1.52690 WP_003088775.1.52810 WP_003088775.1.5289 WP_003088775.1.52939 WP_003088775.1.53169 WP_003088775.1.53427 WP_003088775.1.53528 WP_003088775.1.53586 WP_003088775.1.53663 WP_003088775.1.53719 WP_003088775.1.53826 WP_003088775.1.53946 WP_003088775.1.54076 WP_003088775.1.54078 WP_003088775.1.54140 WP_003088775.1.5427 WP_003088775.1.54462 WP_003088775.1.54571 WP_003088775.1.55 WP_003088775.1.55400 WP_003088775.1.55445 WP_003088775.1.55478 WP_003088775.1.56171 WP_003088775.1.56187 WP_003088775.1.56188 WP_003088775.1.56442 WP_003088775.1.56452 WP_003088775.1.56768 WP_003088775.1.56797 WP_003088775.1.56808 WP_003088775.1.57065 WP_003088775.1.57140 WP_003088775.1.5731 WP_003088775.1.57460 WP_003088775.1.57480 WP_003088775.1.57839 WP_003088775.1.57921 WP_003088775.1.58155 WP_003088775.1.58162 WP_003088775.1.58294 WP_003088775.1.58581 WP_003088775.1.58689 WP_003088775.1.58785 WP_003088775.1.58838 WP_003088775.1.58845 WP_003088775.1.5897 WP_003088775.1.59076 WP_003088775.1.59246 WP_003088775.1.59339 WP_003088775.1.5937 WP_003088775.1.59385 WP_003088775.1.594 WP_003088775.1.59469 WP_003088775.1.59759 WP_003088775.1.59870 WP_003088775.1.59943 WP_003088775.1.60062 WP_003088775.1.60082 WP_003088775.1.60415 WP_003088775.1.60603 WP_003088775.1.60639 WP_003088775.1.60850 WP_003088775.1.60970 WP_003088775.1.61122 WP_003088775.1.61191 WP_003088775.1.61269 WP_003088775.1.61299 WP_003088775.1.61366 WP_003088775.1.61431 WP_003088775.1.61589 WP_003088775.1.616 WP_003088775.1.61696 WP_003088775.1.62396 WP_003088775.1.62516 WP_003088775.1.62534 WP_003088775.1.62701 WP_003088775.1.62834 WP_003088775.1.62961 WP_003088775.1.63369 WP_003088775.1.63659 WP_003088775.1.63929 WP_003088775.1.63941 WP_003088775.1.64340 WP_003088775.1.64433 WP_003088775.1.64603 WP_003088775.1.64605 WP_003088775.1.64611 WP_003088775.1.65009 WP_003088775.1.65095 WP_003088775.1.65099 WP_003088775.1.65197 WP_003088775.1.65227 WP_003088775.1.65237 WP_003088775.1.65247 WP_003088775.1.65337 WP_003088775.1.65588 WP_003088775.1.65867 WP_003088775.1.66062 WP_003088775.1.66088 WP_003088775.1.6629 WP_003088775.1.66345 WP_003088775.1.66364 WP_003088775.1.66371 WP_003088775.1.66526 WP_003088775.1.66693 WP_003088775.1.67010 WP_003088775.1.67124 WP_003088775.1.67269 WP_003088775.1.6734 WP_003088775.1.67388 WP_003088775.1.67686 WP_003088775.1.67874 WP_003088775.1.67937 WP_003088775.1.6796 WP_003088775.1.6808 WP_003088775.1.68158 WP_003088775.1.68162 WP_003088775.1.68448 WP_003088775.1.68541 WP_003088775.1.68561 WP_003088775.1.68568 WP_003088775.1.68862 WP_003088775.1.6931 WP_003088775.1.69599 WP_003088775.1.69791 WP_003088775.1.70098 WP_003088775.1.70561 WP_003088775.1.70650 WP_003088775.1.70693 WP_003088775.1.70831 WP_003088775.1.70991 WP_003088775.1.71290 WP_003088775.1.71610 WP_003088775.1.7219 WP_003088775.1.72331 WP_003088775.1.72378 WP_003088775.1.72447 WP_003088775.1.72662 WP_003088775.1.72669 WP_003088775.1.72782 WP_003088775.1.73035 WP_003088775.1.7308 WP_003088775.1.73149 WP_003088775.1.73172 WP_003088775.1.7329 WP_003088775.1.73490 WP_003088775.1.73791 WP_003088775.1.73889 WP_003088775.1.74 WP_003088775.1.74175 WP_003088775.1.74180 WP_003088775.1.74182 WP_003088775.1.7456 WP_003088775.1.74629 WP_003088775.1.74637 WP_003088775.1.74772 WP_003088775.1.74958 WP_003088775.1.7501 WP_003088775.1.75119 WP_003088775.1.75389 WP_003088775.1.7547 WP_003088775.1.7568 WP_003088775.1.75756 WP_003088775.1.75825 WP_003088775.1.75860 WP_003088775.1.76322 WP_003088775.1.76383 WP_003088775.1.76399 WP_003088775.1.7666 WP_003088775.1.76922 WP_003088775.1.76985 WP_003088775.1.77238 WP_003088775.1.77442 WP_003088775.1.78104 WP_003088775.1.78134 WP_003088775.1.78430 WP_003088775.1.78599 WP_003088775.1.78669 WP_003088775.1.78926 WP_003088775.1.79003 WP_003088775.1.79060 WP_003088775.1.79193 WP_003088775.1.79256 WP_003088775.1.79357 WP_003088775.1.79431 WP_003088775.1.79862 WP_003088775.1.79883 WP_003088775.1.79908 WP_003088775.1.8 WP_003088775.1.80033 WP_003088775.1.80087 WP_003088775.1.8028 WP_003088775.1.80644 WP_003088775.1.80715 WP_003088775.1.80880 WP_003088775.1.80926 WP_003088775.1.80929 WP_003088775.1.81081 WP_003088775.1.81349 WP_003088775.1.8141 WP_003088775.1.81591 WP_003088775.1.81708 WP_003088775.1.81728 WP_003088775.1.81748 WP_003088775.1.81816 WP_003088775.1.81957 WP_003088775.1.81960 WP_003088775.1.82178 WP_003088775.1.8227 WP_003088775.1.82334 WP_003088775.1.82442 WP_003088775.1.82487 WP_003088775.1.82580 WP_003088775.1.82798 WP_003088775.1.82810 WP_003088775.1.82887 WP_003088775.1.83025 WP_003088775.1.83213 WP_003088775.1.83463 WP_003088775.1.8351 WP_003088775.1.83637 WP_003088775.1.83698 WP_003088775.1.83871 WP_003088775.1.83937 WP_003088775.1.84162 WP_003088775.1.84177 WP_003088775.1.84178 WP_003088775.1.84374 WP_003088775.1.84439 WP_003088775.1.84825 WP_003088775.1.84937 WP_003088775.1.85028 WP_003088775.1.85298 WP_003088775.1.85357 WP_003088775.1.85446 WP_003088775.1.85453 WP_003088775.1.85978 WP_003088775.1.86055 WP_003088775.1.86243 WP_003088775.1.86386 WP_003088775.1.8645 WP_003088775.1.86506 WP_003088775.1.86545 WP_003088775.1.86595 WP_003088775.1.86774 WP_003088775.1.86780 WP_003088775.1.86813 WP_003088775.1.86822 WP_003088775.1.86947 WP_003088775.1.87104 WP_003088775.1.87183 WP_003088775.1.87435 WP_003088775.1.87547 WP_003088775.1.87877 WP_003088775.1.87970 WP_003088775.1.87975 WP_003088775.1.88152 WP_003088775.1.88360 WP_003088775.1.88415 WP_003088775.1.88517 WP_003088775.1.8852 WP_003088775.1.88550 WP_003088775.1.88578 WP_003088775.1.88679 WP_003088775.1.88969 WP_003088775.1.89083 WP_003088775.1.89434 WP_003088775.1.89491 WP_003088775.1.89523 WP_003088775.1.89776 WP_003088775.1.89868 WP_003088775.1.89992 WP_003088775.1.90110 WP_003088775.1.90268 WP_003088775.1.90272 WP_003088775.1.90940 WP_003088775.1.90999 WP_003088775.1.91012 WP_003088775.1.91236 WP_003088775.1.91336 WP_003088775.1.91431 WP_003088775.1.91563 WP_003088775.1.91838 WP_003088775.1.91882 WP_003088775.1.92587 WP_003088775.1.92642 WP_003088775.1.9272 WP_003088775.1.92759 WP_003088775.1.92769 WP_003088775.1.93122 WP_003088775.1.93520 WP_003088775.1.93547 WP_003088775.1.93562 WP_003088775.1.94136 WP_003088775.1.94211 WP_003088775.1.94288 WP_003088775.1.94385 WP_003088775.1.94422 WP_003088775.1.9444 WP_003088775.1.94450 WP_003088775.1.94818 WP_003088775.1.94881 WP_003088775.1.95056 WP_003088775.1.95132 WP_003088775.1.95359 WP_003088775.1.95460 WP_003088775.1.95638 WP_003088775.1.95745 WP_003088775.1.95751 WP_003088775.1.95802 WP_003088775.1.96384 WP_003088775.1.96434 WP_003088775.1.96452 WP_003088775.1.96714 WP_003088775.1.96863 WP_003088775.1.9706 WP_003088775.1.97126 WP_003088775.1.9722 WP_003088775.1.97503 WP_003088775.1.977 WP_003088775.1.97784 WP_003088775.1.97877 WP_003088775.1.98515 WP_003088775.1.98672 WP_003088775.1.98926 WP_003088775.1.99389 WP_003088775.1.99516 WP_003088775.1.99757 gi|558677987|ref|YP_008814695.1| gi|386065990|ref|YP_005981294.1| gi|514409454|ref|YP_008132598.1| gi|568154387|ref|YP_008943368.1| 557722.PLES_32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]