SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154461|ref|YP_008943442.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154461|ref|YP_008943442.1|
Domain Number 1 Region: 84-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.87e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568154461|ref|YP_008943442.1|
Sequence length 212
Comment maleylacetoacetate isomerase [Pseudomonas aeruginosa LES431]
Sequence
MKLYTYYRSTSSYRVRIALALKGLDYQSLPVNLVRDGGEHRQPAYLALNPQGRVPALQVD
EGELLIQSPAIIEYLEERYPQPALLSSDPLRRARERGVAALVGCDIHPLHNASVLNLLRQ
WGHDEEQVRQWIGHWVGQGLAAVEQLIGDQGWCFGDRPGLADVYLVPQLYAAERFGVALD
AWPRIRRVADLAAAHPAFRQAHPANQPDTPAA
Download sequence
Identical sequences A0A0C7CRH4 A0A1E9D1N0 A0A1G5LWV9 A0A1S1BWH7
gi|558677911|ref|YP_008814619.1| WP_003100402.1.100071 WP_003100402.1.100179 WP_003100402.1.100394 WP_003100402.1.100420 WP_003100402.1.100456 WP_003100402.1.100473 WP_003100402.1.100723 WP_003100402.1.100777 WP_003100402.1.100809 WP_003100402.1.100810 WP_003100402.1.100995 WP_003100402.1.101021 WP_003100402.1.101090 WP_003100402.1.101642 WP_003100402.1.101739 WP_003100402.1.101809 WP_003100402.1.101819 WP_003100402.1.101871 WP_003100402.1.10201 WP_003100402.1.102045 WP_003100402.1.10257 WP_003100402.1.1037 WP_003100402.1.10407 WP_003100402.1.10482 WP_003100402.1.10529 WP_003100402.1.10572 WP_003100402.1.10641 WP_003100402.1.10684 WP_003100402.1.10856 WP_003100402.1.10949 WP_003100402.1.11026 WP_003100402.1.11058 WP_003100402.1.1107 WP_003100402.1.11077 WP_003100402.1.11388 WP_003100402.1.11410 WP_003100402.1.11417 WP_003100402.1.11454 WP_003100402.1.11653 WP_003100402.1.11744 WP_003100402.1.1180 WP_003100402.1.11847 WP_003100402.1.1187 WP_003100402.1.11943 WP_003100402.1.12208 WP_003100402.1.12240 WP_003100402.1.12302 WP_003100402.1.12354 WP_003100402.1.1238 WP_003100402.1.12497 WP_003100402.1.12530 WP_003100402.1.12561 WP_003100402.1.12657 WP_003100402.1.12670 WP_003100402.1.12687 WP_003100402.1.12838 WP_003100402.1.12873 WP_003100402.1.12934 WP_003100402.1.12970 WP_003100402.1.13 WP_003100402.1.1305 WP_003100402.1.13057 WP_003100402.1.13092 WP_003100402.1.13208 WP_003100402.1.13232 WP_003100402.1.13242 WP_003100402.1.13315 WP_003100402.1.13407 WP_003100402.1.13529 WP_003100402.1.1356 WP_003100402.1.1362 WP_003100402.1.13622 WP_003100402.1.13758 WP_003100402.1.13765 WP_003100402.1.13795 WP_003100402.1.13828 WP_003100402.1.13865 WP_003100402.1.1393 WP_003100402.1.14049 WP_003100402.1.14204 WP_003100402.1.14378 WP_003100402.1.14424 WP_003100402.1.14463 WP_003100402.1.14564 WP_003100402.1.14640 WP_003100402.1.14714 WP_003100402.1.1475 WP_003100402.1.14820 WP_003100402.1.14835 WP_003100402.1.14839 WP_003100402.1.15130 WP_003100402.1.152 WP_003100402.1.15222 WP_003100402.1.15231 WP_003100402.1.15281 WP_003100402.1.15297 WP_003100402.1.15373 WP_003100402.1.15379 WP_003100402.1.15474 WP_003100402.1.15482 WP_003100402.1.15485 WP_003100402.1.15886 WP_003100402.1.15889 WP_003100402.1.16074 WP_003100402.1.16109 WP_003100402.1.16142 WP_003100402.1.162 WP_003100402.1.16239 WP_003100402.1.16242 WP_003100402.1.16279 WP_003100402.1.16419 WP_003100402.1.16660 WP_003100402.1.16694 WP_003100402.1.1671 WP_003100402.1.17155 WP_003100402.1.17354 WP_003100402.1.17370 WP_003100402.1.1739 WP_003100402.1.17397 WP_003100402.1.17566 WP_003100402.1.17697 WP_003100402.1.17883 WP_003100402.1.17890 WP_003100402.1.18052 WP_003100402.1.18117 WP_003100402.1.18547 WP_003100402.1.18735 WP_003100402.1.18892 WP_003100402.1.18911 WP_003100402.1.190 WP_003100402.1.19251 WP_003100402.1.19260 WP_003100402.1.1938 WP_003100402.1.19552 WP_003100402.1.19741 WP_003100402.1.19771 WP_003100402.1.19931 WP_003100402.1.20125 WP_003100402.1.20134 WP_003100402.1.20216 WP_003100402.1.20682 WP_003100402.1.20744 WP_003100402.1.20764 WP_003100402.1.20854 WP_003100402.1.20884 WP_003100402.1.209 WP_003100402.1.20929 WP_003100402.1.21100 WP_003100402.1.21166 WP_003100402.1.21242 WP_003100402.1.21358 WP_003100402.1.2144 WP_003100402.1.21448 WP_003100402.1.21460 WP_003100402.1.21469 WP_003100402.1.21471 WP_003100402.1.21607 WP_003100402.1.21718 WP_003100402.1.2172 WP_003100402.1.21744 WP_003100402.1.21863 WP_003100402.1.21871 WP_003100402.1.21891 WP_003100402.1.21932 WP_003100402.1.221 WP_003100402.1.22324 WP_003100402.1.22394 WP_003100402.1.22442 WP_003100402.1.22477 WP_003100402.1.22491 WP_003100402.1.22573 WP_003100402.1.22671 WP_003100402.1.22704 WP_003100402.1.22729 WP_003100402.1.22863 WP_003100402.1.2289 WP_003100402.1.22891 WP_003100402.1.23013 WP_003100402.1.23195 WP_003100402.1.2323 WP_003100402.1.23394 WP_003100402.1.23512 WP_003100402.1.23523 WP_003100402.1.23559 WP_003100402.1.23581 WP_003100402.1.236 WP_003100402.1.23611 WP_003100402.1.23641 WP_003100402.1.23715 WP_003100402.1.23782 WP_003100402.1.23794 WP_003100402.1.23961 WP_003100402.1.23967 WP_003100402.1.24066 WP_003100402.1.24087 WP_003100402.1.24351 WP_003100402.1.2453 WP_003100402.1.24626 WP_003100402.1.24662 WP_003100402.1.2477 WP_003100402.1.24851 WP_003100402.1.24869 WP_003100402.1.24938 WP_003100402.1.25033 WP_003100402.1.25052 WP_003100402.1.25075 WP_003100402.1.251 WP_003100402.1.2511 WP_003100402.1.25142 WP_003100402.1.25149 WP_003100402.1.25179 WP_003100402.1.25271 WP_003100402.1.25328 WP_003100402.1.25344 WP_003100402.1.25348 WP_003100402.1.25532 WP_003100402.1.25600 WP_003100402.1.25903 WP_003100402.1.2596 WP_003100402.1.25964 WP_003100402.1.26025 WP_003100402.1.261 WP_003100402.1.26159 WP_003100402.1.26428 WP_003100402.1.26463 WP_003100402.1.26489 WP_003100402.1.2652 WP_003100402.1.26539 WP_003100402.1.26592 WP_003100402.1.26681 WP_003100402.1.26705 WP_003100402.1.26740 WP_003100402.1.26816 WP_003100402.1.26841 WP_003100402.1.26906 WP_003100402.1.26967 WP_003100402.1.2698 WP_003100402.1.27018 WP_003100402.1.27028 WP_003100402.1.27107 WP_003100402.1.27211 WP_003100402.1.27259 WP_003100402.1.27534 WP_003100402.1.27587 WP_003100402.1.27687 WP_003100402.1.27738 WP_003100402.1.27783 WP_003100402.1.27837 WP_003100402.1.27858 WP_003100402.1.27939 WP_003100402.1.28064 WP_003100402.1.28258 WP_003100402.1.283 WP_003100402.1.28316 WP_003100402.1.28329 WP_003100402.1.28372 WP_003100402.1.28383 WP_003100402.1.28404 WP_003100402.1.28468 WP_003100402.1.28560 WP_003100402.1.28800 WP_003100402.1.28849 WP_003100402.1.29096 WP_003100402.1.29137 WP_003100402.1.29158 WP_003100402.1.29208 WP_003100402.1.2927 WP_003100402.1.29401 WP_003100402.1.2941 WP_003100402.1.29472 WP_003100402.1.2948 WP_003100402.1.29481 WP_003100402.1.29577 WP_003100402.1.2961 WP_003100402.1.29668 WP_003100402.1.29753 WP_003100402.1.29767 WP_003100402.1.29848 WP_003100402.1.30000 WP_003100402.1.30081 WP_003100402.1.30120 WP_003100402.1.30254 WP_003100402.1.30365 WP_003100402.1.30474 WP_003100402.1.30567 WP_003100402.1.30614 WP_003100402.1.30625 WP_003100402.1.30707 WP_003100402.1.3072 WP_003100402.1.30740 WP_003100402.1.30797 WP_003100402.1.30815 WP_003100402.1.30886 WP_003100402.1.30973 WP_003100402.1.30994 WP_003100402.1.31045 WP_003100402.1.31076 WP_003100402.1.31087 WP_003100402.1.31103 WP_003100402.1.31105 WP_003100402.1.31138 WP_003100402.1.31147 WP_003100402.1.31279 WP_003100402.1.31741 WP_003100402.1.31848 WP_003100402.1.32134 WP_003100402.1.32144 WP_003100402.1.32289 WP_003100402.1.32314 WP_003100402.1.32447 WP_003100402.1.32523 WP_003100402.1.32544 WP_003100402.1.33152 WP_003100402.1.33210 WP_003100402.1.33216 WP_003100402.1.33340 WP_003100402.1.33455 WP_003100402.1.33521 WP_003100402.1.33523 WP_003100402.1.33653 WP_003100402.1.33733 WP_003100402.1.33734 WP_003100402.1.3376 WP_003100402.1.33774 WP_003100402.1.33801 WP_003100402.1.33824 WP_003100402.1.34000 WP_003100402.1.34306 WP_003100402.1.34317 WP_003100402.1.34324 WP_003100402.1.34401 WP_003100402.1.34402 WP_003100402.1.3452 WP_003100402.1.34568 WP_003100402.1.34689 WP_003100402.1.34832 WP_003100402.1.34837 WP_003100402.1.34876 WP_003100402.1.34878 WP_003100402.1.34901 WP_003100402.1.34922 WP_003100402.1.34942 WP_003100402.1.35036 WP_003100402.1.35104 WP_003100402.1.35149 WP_003100402.1.35231 WP_003100402.1.3531 WP_003100402.1.35325 WP_003100402.1.35353 WP_003100402.1.3540 WP_003100402.1.35512 WP_003100402.1.35573 WP_003100402.1.35599 WP_003100402.1.35641 WP_003100402.1.35679 WP_003100402.1.3568 WP_003100402.1.35682 WP_003100402.1.3576 WP_003100402.1.35762 WP_003100402.1.35768 WP_003100402.1.35843 WP_003100402.1.35857 WP_003100402.1.35872 WP_003100402.1.35984 WP_003100402.1.36266 WP_003100402.1.36487 WP_003100402.1.36587 WP_003100402.1.3662 WP_003100402.1.36630 WP_003100402.1.36665 WP_003100402.1.36879 WP_003100402.1.37125 WP_003100402.1.37163 WP_003100402.1.3721 WP_003100402.1.37216 WP_003100402.1.37814 WP_003100402.1.37842 WP_003100402.1.3785 WP_003100402.1.38003 WP_003100402.1.38146 WP_003100402.1.38151 WP_003100402.1.3833 WP_003100402.1.38337 WP_003100402.1.38406 WP_003100402.1.38502 WP_003100402.1.38505 WP_003100402.1.38583 WP_003100402.1.38661 WP_003100402.1.3870 WP_003100402.1.38706 WP_003100402.1.38727 WP_003100402.1.38834 WP_003100402.1.38889 WP_003100402.1.38971 WP_003100402.1.39088 WP_003100402.1.39186 WP_003100402.1.39271 WP_003100402.1.3943 WP_003100402.1.39444 WP_003100402.1.39452 WP_003100402.1.39458 WP_003100402.1.39786 WP_003100402.1.3998 WP_003100402.1.40059 WP_003100402.1.40207 WP_003100402.1.40243 WP_003100402.1.40512 WP_003100402.1.40513 WP_003100402.1.40541 WP_003100402.1.4058 WP_003100402.1.40595 WP_003100402.1.40703 WP_003100402.1.40950 WP_003100402.1.41291 WP_003100402.1.41301 WP_003100402.1.41384 WP_003100402.1.41492 WP_003100402.1.41502 WP_003100402.1.41618 WP_003100402.1.41692 WP_003100402.1.41732 WP_003100402.1.41748 WP_003100402.1.41832 WP_003100402.1.41871 WP_003100402.1.41888 WP_003100402.1.4190 WP_003100402.1.41939 WP_003100402.1.42019 WP_003100402.1.42041 WP_003100402.1.42146 WP_003100402.1.42259 WP_003100402.1.42423 WP_003100402.1.42463 WP_003100402.1.42508 WP_003100402.1.42634 WP_003100402.1.42643 WP_003100402.1.42696 WP_003100402.1.42757 WP_003100402.1.42854 WP_003100402.1.42856 WP_003100402.1.42917 WP_003100402.1.43024 WP_003100402.1.43026 WP_003100402.1.43049 WP_003100402.1.43293 WP_003100402.1.43330 WP_003100402.1.43356 WP_003100402.1.43603 WP_003100402.1.43662 WP_003100402.1.43673 WP_003100402.1.4381 WP_003100402.1.43811 WP_003100402.1.43826 WP_003100402.1.4398 WP_003100402.1.44046 WP_003100402.1.44260 WP_003100402.1.44434 WP_003100402.1.445 WP_003100402.1.44563 WP_003100402.1.44581 WP_003100402.1.44739 WP_003100402.1.45090 WP_003100402.1.45146 WP_003100402.1.45199 WP_003100402.1.4522 WP_003100402.1.45228 WP_003100402.1.45312 WP_003100402.1.4532 WP_003100402.1.45358 WP_003100402.1.45464 WP_003100402.1.45485 WP_003100402.1.45711 WP_003100402.1.45723 WP_003100402.1.45920 WP_003100402.1.45934 WP_003100402.1.45961 WP_003100402.1.461 WP_003100402.1.46152 WP_003100402.1.46200 WP_003100402.1.46436 WP_003100402.1.46755 WP_003100402.1.46787 WP_003100402.1.46826 WP_003100402.1.46846 WP_003100402.1.46926 WP_003100402.1.47101 WP_003100402.1.47150 WP_003100402.1.47155 WP_003100402.1.47158 WP_003100402.1.47251 WP_003100402.1.47296 WP_003100402.1.47312 WP_003100402.1.47469 WP_003100402.1.47480 WP_003100402.1.47527 WP_003100402.1.47598 WP_003100402.1.47645 WP_003100402.1.47774 WP_003100402.1.47930 WP_003100402.1.48001 WP_003100402.1.48024 WP_003100402.1.48178 WP_003100402.1.48321 WP_003100402.1.48334 WP_003100402.1.4836 WP_003100402.1.48378 WP_003100402.1.48474 WP_003100402.1.48545 WP_003100402.1.48820 WP_003100402.1.48842 WP_003100402.1.48870 WP_003100402.1.48961 WP_003100402.1.49265 WP_003100402.1.49266 WP_003100402.1.49277 WP_003100402.1.49293 WP_003100402.1.49360 WP_003100402.1.49500 WP_003100402.1.49557 WP_003100402.1.49688 WP_003100402.1.49798 WP_003100402.1.49842 WP_003100402.1.49988 WP_003100402.1.49998 WP_003100402.1.50176 WP_003100402.1.50180 WP_003100402.1.50222 WP_003100402.1.50242 WP_003100402.1.5043 WP_003100402.1.50668 WP_003100402.1.50989 WP_003100402.1.51019 WP_003100402.1.51183 WP_003100402.1.51267 WP_003100402.1.5132 WP_003100402.1.51501 WP_003100402.1.51549 WP_003100402.1.51682 WP_003100402.1.51807 WP_003100402.1.51889 WP_003100402.1.51937 WP_003100402.1.52146 WP_003100402.1.52152 WP_003100402.1.52220 WP_003100402.1.5226 WP_003100402.1.52537 WP_003100402.1.5258 WP_003100402.1.52583 WP_003100402.1.5260 WP_003100402.1.52690 WP_003100402.1.52700 WP_003100402.1.52728 WP_003100402.1.52784 WP_003100402.1.52810 WP_003100402.1.5294 WP_003100402.1.53169 WP_003100402.1.53267 WP_003100402.1.53351 WP_003100402.1.53427 WP_003100402.1.53486 WP_003100402.1.53663 WP_003100402.1.53826 WP_003100402.1.53932 WP_003100402.1.54078 WP_003100402.1.54133 WP_003100402.1.54140 WP_003100402.1.5420 WP_003100402.1.54248 WP_003100402.1.54462 WP_003100402.1.54497 WP_003100402.1.54571 WP_003100402.1.54809 WP_003100402.1.55089 WP_003100402.1.55169 WP_003100402.1.55318 WP_003100402.1.55400 WP_003100402.1.55478 WP_003100402.1.55543 WP_003100402.1.55729 WP_003100402.1.56013 WP_003100402.1.56145 WP_003100402.1.56171 WP_003100402.1.56187 WP_003100402.1.56188 WP_003100402.1.56228 WP_003100402.1.56315 WP_003100402.1.56442 WP_003100402.1.56474 WP_003100402.1.56632 WP_003100402.1.56797 WP_003100402.1.56808 WP_003100402.1.56819 WP_003100402.1.56973 WP_003100402.1.57140 WP_003100402.1.57276 WP_003100402.1.5731 WP_003100402.1.57460 WP_003100402.1.57532 WP_003100402.1.57548 WP_003100402.1.57728 WP_003100402.1.57839 WP_003100402.1.58056 WP_003100402.1.58155 WP_003100402.1.58162 WP_003100402.1.58183 WP_003100402.1.58193 WP_003100402.1.58228 WP_003100402.1.58294 WP_003100402.1.58436 WP_003100402.1.58482 WP_003100402.1.58785 WP_003100402.1.59076 WP_003100402.1.59246 WP_003100402.1.59249 WP_003100402.1.5937 WP_003100402.1.594 WP_003100402.1.59469 WP_003100402.1.59759 WP_003100402.1.59797 WP_003100402.1.59870 WP_003100402.1.60082 WP_003100402.1.60085 WP_003100402.1.60347 WP_003100402.1.60415 WP_003100402.1.60600 WP_003100402.1.60602 WP_003100402.1.60603 WP_003100402.1.60686 WP_003100402.1.607 WP_003100402.1.60850 WP_003100402.1.60916 WP_003100402.1.61130 WP_003100402.1.61191 WP_003100402.1.61299 WP_003100402.1.6130 WP_003100402.1.61366 WP_003100402.1.61431 WP_003100402.1.61493 WP_003100402.1.61549 WP_003100402.1.61598 WP_003100402.1.62010 WP_003100402.1.62035 WP_003100402.1.62180 WP_003100402.1.62211 WP_003100402.1.62396 WP_003100402.1.62410 WP_003100402.1.62483 WP_003100402.1.62516 WP_003100402.1.62635 WP_003100402.1.62688 WP_003100402.1.62701 WP_003100402.1.62716 WP_003100402.1.62768 WP_003100402.1.62772 WP_003100402.1.6280 WP_003100402.1.6283 WP_003100402.1.62834 WP_003100402.1.62873 WP_003100402.1.63057 WP_003100402.1.63196 WP_003100402.1.63338 WP_003100402.1.63369 WP_003100402.1.63597 WP_003100402.1.63659 WP_003100402.1.64139 WP_003100402.1.64155 WP_003100402.1.64198 WP_003100402.1.64309 WP_003100402.1.64340 WP_003100402.1.64603 WP_003100402.1.64748 WP_003100402.1.64799 WP_003100402.1.64807 WP_003100402.1.64885 WP_003100402.1.64984 WP_003100402.1.65099 WP_003100402.1.65145 WP_003100402.1.65197 WP_003100402.1.65227 WP_003100402.1.65237 WP_003100402.1.65247 WP_003100402.1.65334 WP_003100402.1.65335 WP_003100402.1.65549 WP_003100402.1.65588 WP_003100402.1.65642 WP_003100402.1.65819 WP_003100402.1.65867 WP_003100402.1.6589 WP_003100402.1.65926 WP_003100402.1.66062 WP_003100402.1.66165 WP_003100402.1.66277 WP_003100402.1.66345 WP_003100402.1.66348 WP_003100402.1.66526 WP_003100402.1.66634 WP_003100402.1.66721 WP_003100402.1.66892 WP_003100402.1.66929 WP_003100402.1.66950 WP_003100402.1.67010 WP_003100402.1.67192 WP_003100402.1.67205 WP_003100402.1.67261 WP_003100402.1.67269 WP_003100402.1.6734 WP_003100402.1.67370 WP_003100402.1.67388 WP_003100402.1.67472 WP_003100402.1.67526 WP_003100402.1.67686 WP_003100402.1.67830 WP_003100402.1.67903 WP_003100402.1.68000 WP_003100402.1.6808 WP_003100402.1.68158 WP_003100402.1.68162 WP_003100402.1.68252 WP_003100402.1.68317 WP_003100402.1.6850 WP_003100402.1.68561 WP_003100402.1.68638 WP_003100402.1.68756 WP_003100402.1.68800 WP_003100402.1.68850 WP_003100402.1.68857 WP_003100402.1.68862 WP_003100402.1.68938 WP_003100402.1.69088 WP_003100402.1.69159 WP_003100402.1.69260 WP_003100402.1.6931 WP_003100402.1.6937 WP_003100402.1.69534 WP_003100402.1.69599 WP_003100402.1.69702 WP_003100402.1.69788 WP_003100402.1.69791 WP_003100402.1.69819 WP_003100402.1.69907 WP_003100402.1.69993 WP_003100402.1.70098 WP_003100402.1.70216 WP_003100402.1.70331 WP_003100402.1.70460 WP_003100402.1.7077 WP_003100402.1.70778 WP_003100402.1.70831 WP_003100402.1.71038 WP_003100402.1.7128 WP_003100402.1.71385 WP_003100402.1.71822 WP_003100402.1.71891 WP_003100402.1.71934 WP_003100402.1.72167 WP_003100402.1.72287 WP_003100402.1.72331 WP_003100402.1.72378 WP_003100402.1.72447 WP_003100402.1.72458 WP_003100402.1.72541 WP_003100402.1.72562 WP_003100402.1.72669 WP_003100402.1.7276 WP_003100402.1.72768 WP_003100402.1.73048 WP_003100402.1.73135 WP_003100402.1.73149 WP_003100402.1.73172 WP_003100402.1.7327 WP_003100402.1.7329 WP_003100402.1.73541 WP_003100402.1.73601 WP_003100402.1.73651 WP_003100402.1.73728 WP_003100402.1.7382 WP_003100402.1.73860 WP_003100402.1.73889 WP_003100402.1.73911 WP_003100402.1.74 WP_003100402.1.74000 WP_003100402.1.74072 WP_003100402.1.74074 WP_003100402.1.74175 WP_003100402.1.74180 WP_003100402.1.74219 WP_003100402.1.74264 WP_003100402.1.7445 WP_003100402.1.74458 WP_003100402.1.74473 WP_003100402.1.74518 WP_003100402.1.7456 WP_003100402.1.74568 WP_003100402.1.74772 WP_003100402.1.74776 WP_003100402.1.748 WP_003100402.1.74948 WP_003100402.1.75277 WP_003100402.1.75303 WP_003100402.1.7547 WP_003100402.1.75549 WP_003100402.1.75573 WP_003100402.1.75826 WP_003100402.1.75860 WP_003100402.1.75935 WP_003100402.1.75938 WP_003100402.1.75947 WP_003100402.1.7595 WP_003100402.1.76092 WP_003100402.1.76192 WP_003100402.1.76322 WP_003100402.1.76383 WP_003100402.1.76399 WP_003100402.1.76467 WP_003100402.1.76543 WP_003100402.1.76600 WP_003100402.1.76633 WP_003100402.1.7666 WP_003100402.1.76716 WP_003100402.1.76791 WP_003100402.1.76922 WP_003100402.1.77235 WP_003100402.1.77286 WP_003100402.1.77317 WP_003100402.1.77490 WP_003100402.1.77566 WP_003100402.1.77574 WP_003100402.1.77587 WP_003100402.1.77686 WP_003100402.1.77769 WP_003100402.1.78134 WP_003100402.1.78158 WP_003100402.1.78430 WP_003100402.1.78437 WP_003100402.1.78570 WP_003100402.1.78669 WP_003100402.1.78693 WP_003100402.1.78795 WP_003100402.1.78810 WP_003100402.1.78926 WP_003100402.1.78947 WP_003100402.1.78954 WP_003100402.1.79053 WP_003100402.1.79193 WP_003100402.1.79256 WP_003100402.1.79311 WP_003100402.1.79357 WP_003100402.1.79364 WP_003100402.1.79429 WP_003100402.1.79463 WP_003100402.1.7953 WP_003100402.1.79569 WP_003100402.1.79601 WP_003100402.1.79631 WP_003100402.1.79788 WP_003100402.1.79862 WP_003100402.1.79908 WP_003100402.1.79986 WP_003100402.1.8028 WP_003100402.1.80410 WP_003100402.1.80411 WP_003100402.1.80535 WP_003100402.1.80632 WP_003100402.1.8064 WP_003100402.1.80644 WP_003100402.1.80720 WP_003100402.1.80846 WP_003100402.1.80880 WP_003100402.1.80892 WP_003100402.1.80929 WP_003100402.1.80931 WP_003100402.1.80938 WP_003100402.1.81082 WP_003100402.1.8110 WP_003100402.1.81482 WP_003100402.1.81591 WP_003100402.1.81622 WP_003100402.1.81643 WP_003100402.1.81728 WP_003100402.1.81748 WP_003100402.1.81802 WP_003100402.1.81834 WP_003100402.1.81844 WP_003100402.1.81950 WP_003100402.1.81957 WP_003100402.1.81960 WP_003100402.1.81986 WP_003100402.1.82178 WP_003100402.1.8227 WP_003100402.1.82310 WP_003100402.1.82312 WP_003100402.1.82328 WP_003100402.1.82442 WP_003100402.1.82487 WP_003100402.1.82580 WP_003100402.1.82604 WP_003100402.1.82620 WP_003100402.1.82643 WP_003100402.1.82710 WP_003100402.1.8284 WP_003100402.1.82864 WP_003100402.1.82882 WP_003100402.1.82887 WP_003100402.1.83025 WP_003100402.1.83184 WP_003100402.1.83251 WP_003100402.1.83296 WP_003100402.1.83394 WP_003100402.1.83463 WP_003100402.1.835 WP_003100402.1.8353 WP_003100402.1.8357 WP_003100402.1.83637 WP_003100402.1.83698 WP_003100402.1.83715 WP_003100402.1.84003 WP_003100402.1.84008 WP_003100402.1.84162 WP_003100402.1.84174 WP_003100402.1.84177 WP_003100402.1.84190 WP_003100402.1.84203 WP_003100402.1.84271 WP_003100402.1.84297 WP_003100402.1.8437 WP_003100402.1.84374 WP_003100402.1.84398 WP_003100402.1.84404 WP_003100402.1.84439 WP_003100402.1.8453 WP_003100402.1.84589 WP_003100402.1.84674 WP_003100402.1.8484 WP_003100402.1.84937 WP_003100402.1.8498 WP_003100402.1.85018 WP_003100402.1.85028 WP_003100402.1.85298 WP_003100402.1.85303 WP_003100402.1.85318 WP_003100402.1.85357 WP_003100402.1.85446 WP_003100402.1.85574 WP_003100402.1.85897 WP_003100402.1.85910 WP_003100402.1.86002 WP_003100402.1.86047 WP_003100402.1.86055 WP_003100402.1.86058 WP_003100402.1.86278 WP_003100402.1.86287 WP_003100402.1.86386 WP_003100402.1.865 WP_003100402.1.86545 WP_003100402.1.86552 WP_003100402.1.86652 WP_003100402.1.86774 WP_003100402.1.86780 WP_003100402.1.86785 WP_003100402.1.86947 WP_003100402.1.86985 WP_003100402.1.8718 WP_003100402.1.87183 WP_003100402.1.87316 WP_003100402.1.87435 WP_003100402.1.87530 WP_003100402.1.87547 WP_003100402.1.87970 WP_003100402.1.87981 WP_003100402.1.87987 WP_003100402.1.88004 WP_003100402.1.88308 WP_003100402.1.88360 WP_003100402.1.88517 WP_003100402.1.8852 WP_003100402.1.88550 WP_003100402.1.88578 WP_003100402.1.88659 WP_003100402.1.88679 WP_003100402.1.88680 WP_003100402.1.88714 WP_003100402.1.88900 WP_003100402.1.88969 WP_003100402.1.89083 WP_003100402.1.89098 WP_003100402.1.8911 WP_003100402.1.89245 WP_003100402.1.89434 WP_003100402.1.89440 WP_003100402.1.89577 WP_003100402.1.89610 WP_003100402.1.89638 WP_003100402.1.89662 WP_003100402.1.89736 WP_003100402.1.89776 WP_003100402.1.89866 WP_003100402.1.89867 WP_003100402.1.89868 WP_003100402.1.89886 WP_003100402.1.90032 WP_003100402.1.90110 WP_003100402.1.90189 WP_003100402.1.90224 WP_003100402.1.90242 WP_003100402.1.90268 WP_003100402.1.90306 WP_003100402.1.90412 WP_003100402.1.90569 WP_003100402.1.90655 WP_003100402.1.90940 WP_003100402.1.90999 WP_003100402.1.91093 WP_003100402.1.9120 WP_003100402.1.91204 WP_003100402.1.91336 WP_003100402.1.91360 WP_003100402.1.9143 WP_003100402.1.91431 WP_003100402.1.91438 WP_003100402.1.91563 WP_003100402.1.91585 WP_003100402.1.91803 WP_003100402.1.91838 WP_003100402.1.91846 WP_003100402.1.91860 WP_003100402.1.9191 WP_003100402.1.91938 WP_003100402.1.91996 WP_003100402.1.92321 WP_003100402.1.92454 WP_003100402.1.92573 WP_003100402.1.92585 WP_003100402.1.92587 WP_003100402.1.92624 WP_003100402.1.92642 WP_003100402.1.9272 WP_003100402.1.92769 WP_003100402.1.92894 WP_003100402.1.92924 WP_003100402.1.92930 WP_003100402.1.93001 WP_003100402.1.93090 WP_003100402.1.93144 WP_003100402.1.93148 WP_003100402.1.93250 WP_003100402.1.9328 WP_003100402.1.93446 WP_003100402.1.93498 WP_003100402.1.93547 WP_003100402.1.93562 WP_003100402.1.93797 WP_003100402.1.93848 WP_003100402.1.94004 WP_003100402.1.94136 WP_003100402.1.94174 WP_003100402.1.94211 WP_003100402.1.94218 WP_003100402.1.94243 WP_003100402.1.94285 WP_003100402.1.9444 WP_003100402.1.94682 WP_003100402.1.94814 WP_003100402.1.94818 WP_003100402.1.94896 WP_003100402.1.95027 WP_003100402.1.95056 WP_003100402.1.95117 WP_003100402.1.95132 WP_003100402.1.95187 WP_003100402.1.95305 WP_003100402.1.95359 WP_003100402.1.95460 WP_003100402.1.95488 WP_003100402.1.95525 WP_003100402.1.95638 WP_003100402.1.95774 WP_003100402.1.95787 WP_003100402.1.95820 WP_003100402.1.95825 WP_003100402.1.9599 WP_003100402.1.95994 WP_003100402.1.95999 WP_003100402.1.96008 WP_003100402.1.9604 WP_003100402.1.96134 WP_003100402.1.96193 WP_003100402.1.96243 WP_003100402.1.96267 WP_003100402.1.96357 WP_003100402.1.96384 WP_003100402.1.96434 WP_003100402.1.96452 WP_003100402.1.96506 WP_003100402.1.96702 WP_003100402.1.96714 WP_003100402.1.9706 WP_003100402.1.97118 WP_003100402.1.97126 WP_003100402.1.97213 WP_003100402.1.9722 WP_003100402.1.97271 WP_003100402.1.97272 WP_003100402.1.97474 WP_003100402.1.97614 WP_003100402.1.977 WP_003100402.1.97826 WP_003100402.1.97877 WP_003100402.1.97968 WP_003100402.1.98260 WP_003100402.1.98276 WP_003100402.1.98410 WP_003100402.1.98414 WP_003100402.1.98515 WP_003100402.1.98522 WP_003100402.1.98610 WP_003100402.1.98678 WP_003100402.1.98693 WP_003100402.1.98814 WP_003100402.1.98958 WP_003100402.1.98960 WP_003100402.1.99353 WP_003100402.1.99389 WP_003100402.1.99461 WP_003100402.1.9951 WP_003100402.1.99516 WP_003100402.1.99654 WP_003100402.1.99757 WP_003100402.1.99795 WP_003100402.1.9989 gi|392984517|ref|YP_006483104.1| 557722.PLES_33161 gi|218892035|ref|YP_002440902.1| gi|568154461|ref|YP_008943442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]