SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154581|ref|YP_008943563.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154581|ref|YP_008943563.1|
Domain Number 1 Region: 80-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.57e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568154581|ref|YP_008943563.1|
Sequence length 207
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MLEILGKASSINVRKVLWTCAELDLPYRREDWGSGFRDTHAAEFLALNPNAMVPVLRDGE
LVLWESNSIIRYLANRYAGERLYPQQAAPRARVDQWLDWQASDLNRSWSYAFMSLVRQSP
AHRDAAQVEASLRGWTGFMEILEGQLLRTGAYVAGETFSLADIAIGLSVNRWYETPFEHP
SLPAVRAYYERLGARPGFLAHGRNGVP
Download sequence
Identical sequences A0A071KT77 A0A0E1AUR7 A0A0H2Z9Y0 A0A0H3QPH1 A0A157WNI0 A0A1C7BNC9 A0A1F0IRJ7 A0A1G5HCS2 A0A1S1BZL0 Q9I2K7 V6AGN4
gi|116049844|ref|YP_791349.1| 208963.PA14_40070 208964.PA1890 557722.PLES_34341 gi|218892153|ref|YP_002441020.1| gi|478479325|ref|YP_007709976.1| gi|15597087|ref|NP_250581.1| gi|568310242|ref|YP_008982511.1| gi|386065741|ref|YP_005981045.1| NP_250581.1.87394 WP_003088140.1.100100 WP_003088140.1.100276 WP_003088140.1.100278 WP_003088140.1.100456 WP_003088140.1.100469 WP_003088140.1.100473 WP_003088140.1.100476 WP_003088140.1.100523 WP_003088140.1.100654 WP_003088140.1.100742 WP_003088140.1.100786 WP_003088140.1.100808 WP_003088140.1.100872 WP_003088140.1.100983 WP_003088140.1.101090 WP_003088140.1.101269 WP_003088140.1.101340 WP_003088140.1.101506 WP_003088140.1.101572 WP_003088140.1.101590 WP_003088140.1.101712 WP_003088140.1.10174 WP_003088140.1.101781 WP_003088140.1.10179 WP_003088140.1.101809 WP_003088140.1.101819 WP_003088140.1.10185 WP_003088140.1.101863 WP_003088140.1.10202 WP_003088140.1.10204 WP_003088140.1.10228 WP_003088140.1.10248 WP_003088140.1.10271 WP_003088140.1.1037 WP_003088140.1.10419 WP_003088140.1.10435 WP_003088140.1.10457 WP_003088140.1.10468 WP_003088140.1.10477 WP_003088140.1.10529 WP_003088140.1.10548 WP_003088140.1.10575 WP_003088140.1.10636 WP_003088140.1.10684 WP_003088140.1.10764 WP_003088140.1.10895 WP_003088140.1.11026 WP_003088140.1.11058 WP_003088140.1.1107 WP_003088140.1.11130 WP_003088140.1.11163 WP_003088140.1.11178 WP_003088140.1.11318 WP_003088140.1.11381 WP_003088140.1.11410 WP_003088140.1.11417 WP_003088140.1.11568 WP_003088140.1.1183 WP_003088140.1.11854 WP_003088140.1.1187 WP_003088140.1.11943 WP_003088140.1.12018 WP_003088140.1.12120 WP_003088140.1.12150 WP_003088140.1.12200 WP_003088140.1.12208 WP_003088140.1.12240 WP_003088140.1.12302 WP_003088140.1.12400 WP_003088140.1.12497 WP_003088140.1.12547 WP_003088140.1.12561 WP_003088140.1.12660 WP_003088140.1.12670 WP_003088140.1.12687 WP_003088140.1.12744 WP_003088140.1.12797 WP_003088140.1.12838 WP_003088140.1.12890 WP_003088140.1.12891 WP_003088140.1.12922 WP_003088140.1.12934 WP_003088140.1.12980 WP_003088140.1.13041 WP_003088140.1.13077 WP_003088140.1.13085 WP_003088140.1.13208 WP_003088140.1.13232 WP_003088140.1.13270 WP_003088140.1.1333 WP_003088140.1.13364 WP_003088140.1.13407 WP_003088140.1.13529 WP_003088140.1.13533 WP_003088140.1.13642 WP_003088140.1.13718 WP_003088140.1.13743 WP_003088140.1.13758 WP_003088140.1.13785 WP_003088140.1.13795 WP_003088140.1.13828 WP_003088140.1.1393 WP_003088140.1.14078 WP_003088140.1.14096 WP_003088140.1.14116 WP_003088140.1.14204 WP_003088140.1.14251 WP_003088140.1.14378 WP_003088140.1.14424 WP_003088140.1.14460 WP_003088140.1.14476 WP_003088140.1.14564 WP_003088140.1.14679 WP_003088140.1.14690 WP_003088140.1.14714 WP_003088140.1.1475 WP_003088140.1.14754 WP_003088140.1.14815 WP_003088140.1.14835 WP_003088140.1.14883 WP_003088140.1.14966 WP_003088140.1.14981 WP_003088140.1.15004 WP_003088140.1.15130 WP_003088140.1.1516 WP_003088140.1.152 WP_003088140.1.15222 WP_003088140.1.15231 WP_003088140.1.15281 WP_003088140.1.15379 WP_003088140.1.15408 WP_003088140.1.15480 WP_003088140.1.15482 WP_003088140.1.15606 WP_003088140.1.15692 WP_003088140.1.15886 WP_003088140.1.15889 WP_003088140.1.15934 WP_003088140.1.16041 WP_003088140.1.16142 WP_003088140.1.16197 WP_003088140.1.162 WP_003088140.1.16239 WP_003088140.1.16267 WP_003088140.1.16279 WP_003088140.1.16419 WP_003088140.1.1646 WP_003088140.1.16694 WP_003088140.1.1670 WP_003088140.1.16751 WP_003088140.1.16782 WP_003088140.1.16788 WP_003088140.1.16801 WP_003088140.1.16808 WP_003088140.1.16811 WP_003088140.1.16895 WP_003088140.1.17022 WP_003088140.1.1704 WP_003088140.1.17108 WP_003088140.1.17155 WP_003088140.1.17162 WP_003088140.1.17177 WP_003088140.1.17189 WP_003088140.1.172 WP_003088140.1.17223 WP_003088140.1.17353 WP_003088140.1.17354 WP_003088140.1.17370 WP_003088140.1.17499 WP_003088140.1.18052 WP_003088140.1.18117 WP_003088140.1.18156 WP_003088140.1.18157 WP_003088140.1.18199 WP_003088140.1.18204 WP_003088140.1.18234 WP_003088140.1.1824 WP_003088140.1.18349 WP_003088140.1.18440 WP_003088140.1.18493 WP_003088140.1.18508 WP_003088140.1.18653 WP_003088140.1.18732 WP_003088140.1.18735 WP_003088140.1.18795 WP_003088140.1.18852 WP_003088140.1.18892 WP_003088140.1.18907 WP_003088140.1.18930 WP_003088140.1.19089 WP_003088140.1.19199 WP_003088140.1.19251 WP_003088140.1.19260 WP_003088140.1.19269 WP_003088140.1.19346 WP_003088140.1.19351 WP_003088140.1.19376 WP_003088140.1.19552 WP_003088140.1.19591 WP_003088140.1.19640 WP_003088140.1.19703 WP_003088140.1.1971 WP_003088140.1.19711 WP_003088140.1.19718 WP_003088140.1.19741 WP_003088140.1.19803 WP_003088140.1.19824 WP_003088140.1.20024 WP_003088140.1.20070 WP_003088140.1.2012 WP_003088140.1.20134 WP_003088140.1.20154 WP_003088140.1.20342 WP_003088140.1.20590 WP_003088140.1.20682 WP_003088140.1.20825 WP_003088140.1.20854 WP_003088140.1.20880 WP_003088140.1.20890 WP_003088140.1.20929 WP_003088140.1.20978 WP_003088140.1.21002 WP_003088140.1.21039 WP_003088140.1.21096 WP_003088140.1.21209 WP_003088140.1.21253 WP_003088140.1.21302 WP_003088140.1.21358 WP_003088140.1.21471 WP_003088140.1.21517 WP_003088140.1.21718 WP_003088140.1.21744 WP_003088140.1.21767 WP_003088140.1.21782 WP_003088140.1.21801 WP_003088140.1.21863 WP_003088140.1.21871 WP_003088140.1.21891 WP_003088140.1.22078 WP_003088140.1.221 WP_003088140.1.2228 WP_003088140.1.22316 WP_003088140.1.22324 WP_003088140.1.22365 WP_003088140.1.2237 WP_003088140.1.22389 WP_003088140.1.22477 WP_003088140.1.22491 WP_003088140.1.22573 WP_003088140.1.22729 WP_003088140.1.22863 WP_003088140.1.23013 WP_003088140.1.23166 WP_003088140.1.23191 WP_003088140.1.23195 WP_003088140.1.2323 WP_003088140.1.23264 WP_003088140.1.23394 WP_003088140.1.23418 WP_003088140.1.23421 WP_003088140.1.23512 WP_003088140.1.23523 WP_003088140.1.23525 WP_003088140.1.2355 WP_003088140.1.23559 WP_003088140.1.23611 WP_003088140.1.23715 WP_003088140.1.23769 WP_003088140.1.23782 WP_003088140.1.23794 WP_003088140.1.23884 WP_003088140.1.23925 WP_003088140.1.23938 WP_003088140.1.23967 WP_003088140.1.23983 WP_003088140.1.24077 WP_003088140.1.24087 WP_003088140.1.24101 WP_003088140.1.24183 WP_003088140.1.24234 WP_003088140.1.24319 WP_003088140.1.24351 WP_003088140.1.24413 WP_003088140.1.2453 WP_003088140.1.24626 WP_003088140.1.24662 WP_003088140.1.2477 WP_003088140.1.24862 WP_003088140.1.24869 WP_003088140.1.24879 WP_003088140.1.24938 WP_003088140.1.25033 WP_003088140.1.25052 WP_003088140.1.25067 WP_003088140.1.25075 WP_003088140.1.251 WP_003088140.1.25109 WP_003088140.1.2511 WP_003088140.1.25142 WP_003088140.1.25179 WP_003088140.1.25271 WP_003088140.1.2529 WP_003088140.1.2530 WP_003088140.1.2535 WP_003088140.1.25477 WP_003088140.1.25641 WP_003088140.1.25675 WP_003088140.1.25695 WP_003088140.1.2572 WP_003088140.1.25834 WP_003088140.1.2596 WP_003088140.1.26025 WP_003088140.1.26159 WP_003088140.1.26301 WP_003088140.1.26428 WP_003088140.1.26473 WP_003088140.1.26489 WP_003088140.1.2652 WP_003088140.1.26553 WP_003088140.1.26592 WP_003088140.1.26604 WP_003088140.1.26681 WP_003088140.1.26682 WP_003088140.1.26705 WP_003088140.1.26740 WP_003088140.1.26816 WP_003088140.1.26841 WP_003088140.1.26862 WP_003088140.1.26906 WP_003088140.1.26967 WP_003088140.1.2698 WP_003088140.1.27028 WP_003088140.1.27039 WP_003088140.1.27211 WP_003088140.1.27259 WP_003088140.1.27288 WP_003088140.1.27549 WP_003088140.1.27575 WP_003088140.1.27587 WP_003088140.1.27687 WP_003088140.1.27772 WP_003088140.1.27783 WP_003088140.1.27837 WP_003088140.1.27933 WP_003088140.1.27939 WP_003088140.1.27966 WP_003088140.1.28057 WP_003088140.1.28064 WP_003088140.1.28136 WP_003088140.1.28258 WP_003088140.1.28372 WP_003088140.1.28383 WP_003088140.1.28404 WP_003088140.1.28505 WP_003088140.1.28528 WP_003088140.1.28560 WP_003088140.1.28602 WP_003088140.1.28757 WP_003088140.1.28800 WP_003088140.1.28823 WP_003088140.1.28838 WP_003088140.1.28878 WP_003088140.1.28920 WP_003088140.1.29003 WP_003088140.1.29008 WP_003088140.1.29062 WP_003088140.1.29070 WP_003088140.1.29096 WP_003088140.1.29127 WP_003088140.1.29137 WP_003088140.1.29179 WP_003088140.1.2927 WP_003088140.1.29401 WP_003088140.1.2941 WP_003088140.1.29472 WP_003088140.1.2948 WP_003088140.1.29481 WP_003088140.1.29577 WP_003088140.1.2961 WP_003088140.1.29650 WP_003088140.1.29753 WP_003088140.1.29767 WP_003088140.1.2980 WP_003088140.1.29848 WP_003088140.1.29958 WP_003088140.1.30000 WP_003088140.1.30020 WP_003088140.1.30081 WP_003088140.1.30120 WP_003088140.1.30254 WP_003088140.1.3030 WP_003088140.1.30365 WP_003088140.1.30475 WP_003088140.1.30563 WP_003088140.1.30614 WP_003088140.1.30615 WP_003088140.1.30625 WP_003088140.1.3072 WP_003088140.1.30842 WP_003088140.1.30973 WP_003088140.1.30994 WP_003088140.1.31045 WP_003088140.1.31103 WP_003088140.1.31279 WP_003088140.1.31457 WP_003088140.1.31501 WP_003088140.1.31563 WP_003088140.1.31565 WP_003088140.1.31587 WP_003088140.1.31633 WP_003088140.1.31655 WP_003088140.1.3172 WP_003088140.1.31741 WP_003088140.1.31751 WP_003088140.1.3179 WP_003088140.1.31852 WP_003088140.1.3189 WP_003088140.1.319 WP_003088140.1.31939 WP_003088140.1.32134 WP_003088140.1.32137 WP_003088140.1.32144 WP_003088140.1.32235 WP_003088140.1.32289 WP_003088140.1.32314 WP_003088140.1.32359 WP_003088140.1.32447 WP_003088140.1.32544 WP_003088140.1.32596 WP_003088140.1.32626 WP_003088140.1.32641 WP_003088140.1.32711 WP_003088140.1.32821 WP_003088140.1.32869 WP_003088140.1.32998 WP_003088140.1.33009 WP_003088140.1.33047 WP_003088140.1.33186 WP_003088140.1.33210 WP_003088140.1.33294 WP_003088140.1.33340 WP_003088140.1.33387 WP_003088140.1.33438 WP_003088140.1.3351 WP_003088140.1.33523 WP_003088140.1.33547 WP_003088140.1.33549 WP_003088140.1.33653 WP_003088140.1.33669 WP_003088140.1.3368 WP_003088140.1.33728 WP_003088140.1.33734 WP_003088140.1.3376 WP_003088140.1.33774 WP_003088140.1.33814 WP_003088140.1.33822 WP_003088140.1.33824 WP_003088140.1.33833 WP_003088140.1.33945 WP_003088140.1.34039 WP_003088140.1.34136 WP_003088140.1.34143 WP_003088140.1.34150 WP_003088140.1.34151 WP_003088140.1.34180 WP_003088140.1.34191 WP_003088140.1.34306 WP_003088140.1.34317 WP_003088140.1.3436 WP_003088140.1.34461 WP_003088140.1.34472 WP_003088140.1.3452 WP_003088140.1.34556 WP_003088140.1.34568 WP_003088140.1.34625 WP_003088140.1.34670 WP_003088140.1.34784 WP_003088140.1.34821 WP_003088140.1.34832 WP_003088140.1.34836 WP_003088140.1.34837 WP_003088140.1.34876 WP_003088140.1.34878 WP_003088140.1.35036 WP_003088140.1.35149 WP_003088140.1.35231 WP_003088140.1.35325 WP_003088140.1.35431 WP_003088140.1.35442 WP_003088140.1.35480 WP_003088140.1.35529 WP_003088140.1.3555 WP_003088140.1.35573 WP_003088140.1.35599 WP_003088140.1.35639 WP_003088140.1.35641 WP_003088140.1.35669 WP_003088140.1.3576 WP_003088140.1.35762 WP_003088140.1.35822 WP_003088140.1.35857 WP_003088140.1.35968 WP_003088140.1.35984 WP_003088140.1.36064 WP_003088140.1.36121 WP_003088140.1.36148 WP_003088140.1.36266 WP_003088140.1.36267 WP_003088140.1.36285 WP_003088140.1.36435 WP_003088140.1.36521 WP_003088140.1.3653 WP_003088140.1.36608 WP_003088140.1.36630 WP_003088140.1.36708 WP_003088140.1.3672 WP_003088140.1.36756 WP_003088140.1.36781 WP_003088140.1.36879 WP_003088140.1.37125 WP_003088140.1.373 WP_003088140.1.37366 WP_003088140.1.3742 WP_003088140.1.37500 WP_003088140.1.37571 WP_003088140.1.3768 WP_003088140.1.37703 WP_003088140.1.3781 WP_003088140.1.37818 WP_003088140.1.37826 WP_003088140.1.3785 WP_003088140.1.38003 WP_003088140.1.38023 WP_003088140.1.38060 WP_003088140.1.38087 WP_003088140.1.38102 WP_003088140.1.3818 WP_003088140.1.3821 WP_003088140.1.38319 WP_003088140.1.3833 WP_003088140.1.38335 WP_003088140.1.38510 WP_003088140.1.38582 WP_003088140.1.38587 WP_003088140.1.38657 WP_003088140.1.3870 WP_003088140.1.38816 WP_003088140.1.3887 WP_003088140.1.38971 WP_003088140.1.39046 WP_003088140.1.39088 WP_003088140.1.39122 WP_003088140.1.39326 WP_003088140.1.39345 WP_003088140.1.3943 WP_003088140.1.39452 WP_003088140.1.39537 WP_003088140.1.39765 WP_003088140.1.39811 WP_003088140.1.39920 WP_003088140.1.39949 WP_003088140.1.3998 WP_003088140.1.39989 WP_003088140.1.40115 WP_003088140.1.40135 WP_003088140.1.40207 WP_003088140.1.40271 WP_003088140.1.40419 WP_003088140.1.40442 WP_003088140.1.40541 WP_003088140.1.40546 WP_003088140.1.4058 WP_003088140.1.40950 WP_003088140.1.40984 WP_003088140.1.40993 WP_003088140.1.41110 WP_003088140.1.41137 WP_003088140.1.41199 WP_003088140.1.41290 WP_003088140.1.41291 WP_003088140.1.41412 WP_003088140.1.41429 WP_003088140.1.41487 WP_003088140.1.41502 WP_003088140.1.41618 WP_003088140.1.41625 WP_003088140.1.41692 WP_003088140.1.41703 WP_003088140.1.41748 WP_003088140.1.41773 WP_003088140.1.41846 WP_003088140.1.41871 WP_003088140.1.42 WP_003088140.1.42019 WP_003088140.1.42041 WP_003088140.1.42047 WP_003088140.1.42259 WP_003088140.1.42294 WP_003088140.1.42316 WP_003088140.1.42381 WP_003088140.1.42423 WP_003088140.1.42499 WP_003088140.1.42508 WP_003088140.1.42634 WP_003088140.1.42643 WP_003088140.1.42690 WP_003088140.1.42723 WP_003088140.1.4273 WP_003088140.1.42789 WP_003088140.1.42854 WP_003088140.1.42870 WP_003088140.1.42917 WP_003088140.1.42946 WP_003088140.1.42952 WP_003088140.1.42972 WP_003088140.1.42973 WP_003088140.1.43022 WP_003088140.1.43024 WP_003088140.1.43049 WP_003088140.1.43107 WP_003088140.1.43212 WP_003088140.1.43245 WP_003088140.1.43286 WP_003088140.1.43326 WP_003088140.1.43330 WP_003088140.1.43356 WP_003088140.1.4348 WP_003088140.1.43593 WP_003088140.1.43603 WP_003088140.1.43662 WP_003088140.1.43667 WP_003088140.1.43673 WP_003088140.1.43696 WP_003088140.1.43729 WP_003088140.1.43756 WP_003088140.1.43783 WP_003088140.1.43802 WP_003088140.1.4397 WP_003088140.1.4398 WP_003088140.1.43998 WP_003088140.1.44094 WP_003088140.1.44269 WP_003088140.1.44373 WP_003088140.1.44434 WP_003088140.1.44486 WP_003088140.1.445 WP_003088140.1.44552 WP_003088140.1.44565 WP_003088140.1.44725 WP_003088140.1.44739 WP_003088140.1.44760 WP_003088140.1.44804 WP_003088140.1.44870 WP_003088140.1.4493 WP_003088140.1.44959 WP_003088140.1.45063 WP_003088140.1.45090 WP_003088140.1.45199 WP_003088140.1.45202 WP_003088140.1.4522 WP_003088140.1.45298 WP_003088140.1.45306 WP_003088140.1.45312 WP_003088140.1.4532 WP_003088140.1.45328 WP_003088140.1.45353 WP_003088140.1.45358 WP_003088140.1.45478 WP_003088140.1.45485 WP_003088140.1.45604 WP_003088140.1.45611 WP_003088140.1.45636 WP_003088140.1.45700 WP_003088140.1.45818 WP_003088140.1.45920 WP_003088140.1.45934 WP_003088140.1.45946 WP_003088140.1.46010 WP_003088140.1.46032 WP_003088140.1.46093 WP_003088140.1.46152 WP_003088140.1.46306 WP_003088140.1.4640 WP_003088140.1.46436 WP_003088140.1.46623 WP_003088140.1.46787 WP_003088140.1.46826 WP_003088140.1.46866 WP_003088140.1.46885 WP_003088140.1.4699 WP_003088140.1.47158 WP_003088140.1.47314 WP_003088140.1.47374 WP_003088140.1.47469 WP_003088140.1.47527 WP_003088140.1.47551 WP_003088140.1.47774 WP_003088140.1.47930 WP_003088140.1.48024 WP_003088140.1.48141 WP_003088140.1.48178 WP_003088140.1.48321 WP_003088140.1.48334 WP_003088140.1.48382 WP_003088140.1.48413 WP_003088140.1.48472 WP_003088140.1.48474 WP_003088140.1.48487 WP_003088140.1.48545 WP_003088140.1.48576 WP_003088140.1.48579 WP_003088140.1.48747 WP_003088140.1.48840 WP_003088140.1.48851 WP_003088140.1.48961 WP_003088140.1.49108 WP_003088140.1.49135 WP_003088140.1.49184 WP_003088140.1.49266 WP_003088140.1.49286 WP_003088140.1.49293 WP_003088140.1.49360 WP_003088140.1.49416 WP_003088140.1.49500 WP_003088140.1.49557 WP_003088140.1.49566 WP_003088140.1.49806 WP_003088140.1.49833 WP_003088140.1.49842 WP_003088140.1.49948 WP_003088140.1.49976 WP_003088140.1.49988 WP_003088140.1.50180 WP_003088140.1.50222 WP_003088140.1.50242 WP_003088140.1.50450 WP_003088140.1.50459 WP_003088140.1.50567 WP_003088140.1.50653 WP_003088140.1.50668 WP_003088140.1.50691 WP_003088140.1.50734 WP_003088140.1.50783 WP_003088140.1.50814 WP_003088140.1.50922 WP_003088140.1.50967 WP_003088140.1.51035 WP_003088140.1.51136 WP_003088140.1.51141 WP_003088140.1.51273 WP_003088140.1.51457 WP_003088140.1.51538 WP_003088140.1.51727 WP_003088140.1.51733 WP_003088140.1.51889 WP_003088140.1.51917 WP_003088140.1.51937 WP_003088140.1.51943 WP_003088140.1.51957 WP_003088140.1.51976 WP_003088140.1.52043 WP_003088140.1.52212 WP_003088140.1.52244 WP_003088140.1.5226 WP_003088140.1.52326 WP_003088140.1.52334 WP_003088140.1.5235 WP_003088140.1.52355 WP_003088140.1.52372 WP_003088140.1.52403 WP_003088140.1.52409 WP_003088140.1.52449 WP_003088140.1.52500 WP_003088140.1.52591 WP_003088140.1.5260 WP_003088140.1.52690 WP_003088140.1.52697 WP_003088140.1.52728 WP_003088140.1.52790 WP_003088140.1.52850 WP_003088140.1.5289 WP_003088140.1.52939 WP_003088140.1.53038 WP_003088140.1.53070 WP_003088140.1.53072 WP_003088140.1.53267 WP_003088140.1.53287 WP_003088140.1.53351 WP_003088140.1.53414 WP_003088140.1.53427 WP_003088140.1.53486 WP_003088140.1.53528 WP_003088140.1.53530 WP_003088140.1.53586 WP_003088140.1.53663 WP_003088140.1.53678 WP_003088140.1.53719 WP_003088140.1.53726 WP_003088140.1.53946 WP_003088140.1.53948 WP_003088140.1.5399 WP_003088140.1.54003 WP_003088140.1.54076 WP_003088140.1.54090 WP_003088140.1.54133 WP_003088140.1.54140 WP_003088140.1.54146 WP_003088140.1.5420 WP_003088140.1.54248 WP_003088140.1.5427 WP_003088140.1.54293 WP_003088140.1.54462 WP_003088140.1.54497 WP_003088140.1.54571 WP_003088140.1.54974 WP_003088140.1.55 WP_003088140.1.55318 WP_003088140.1.55347 WP_003088140.1.55387 WP_003088140.1.55400 WP_003088140.1.55543 WP_003088140.1.55729 WP_003088140.1.55813 WP_003088140.1.55976 WP_003088140.1.56145 WP_003088140.1.56187 WP_003088140.1.56196 WP_003088140.1.56228 WP_003088140.1.56229 WP_003088140.1.56442 WP_003088140.1.56452 WP_003088140.1.56465 WP_003088140.1.56474 WP_003088140.1.56475 WP_003088140.1.56623 WP_003088140.1.56626 WP_003088140.1.56632 WP_003088140.1.56745 WP_003088140.1.56768 WP_003088140.1.56797 WP_003088140.1.56837 WP_003088140.1.56864 WP_003088140.1.56896 WP_003088140.1.57020 WP_003088140.1.57065 WP_003088140.1.57113 WP_003088140.1.5731 WP_003088140.1.57339 WP_003088140.1.57369 WP_003088140.1.57417 WP_003088140.1.57477 WP_003088140.1.57480 WP_003088140.1.57532 WP_003088140.1.57548 WP_003088140.1.57728 WP_003088140.1.57792 WP_003088140.1.57841 WP_003088140.1.57853 WP_003088140.1.57921 WP_003088140.1.57966 WP_003088140.1.58019 WP_003088140.1.58056 WP_003088140.1.58200 WP_003088140.1.58360 WP_003088140.1.58417 WP_003088140.1.58436 WP_003088140.1.5850 WP_003088140.1.58510 WP_003088140.1.58527 WP_003088140.1.5856 WP_003088140.1.58581 WP_003088140.1.58689 WP_003088140.1.58800 WP_003088140.1.58838 WP_003088140.1.58845 WP_003088140.1.5889 WP_003088140.1.58944 WP_003088140.1.58952 WP_003088140.1.5897 WP_003088140.1.59013 WP_003088140.1.59076 WP_003088140.1.59099 WP_003088140.1.59158 WP_003088140.1.59212 WP_003088140.1.59246 WP_003088140.1.59339 WP_003088140.1.59376 WP_003088140.1.59385 WP_003088140.1.59688 WP_003088140.1.59724 WP_003088140.1.59797 WP_003088140.1.59870 WP_003088140.1.59943 WP_003088140.1.60062 WP_003088140.1.60084 WP_003088140.1.60085 WP_003088140.1.60206 WP_003088140.1.60261 WP_003088140.1.60347 WP_003088140.1.60364 WP_003088140.1.60396 WP_003088140.1.60415 WP_003088140.1.60467 WP_003088140.1.60472 WP_003088140.1.60509 WP_003088140.1.60603 WP_003088140.1.607 WP_003088140.1.60850 WP_003088140.1.60910 WP_003088140.1.60970 WP_003088140.1.61122 WP_003088140.1.61222 WP_003088140.1.61269 WP_003088140.1.61288 WP_003088140.1.61294 WP_003088140.1.61431 WP_003088140.1.61493 WP_003088140.1.61549 WP_003088140.1.61589 WP_003088140.1.616 WP_003088140.1.61696 WP_003088140.1.6173 WP_003088140.1.61943 WP_003088140.1.62035 WP_003088140.1.62180 WP_003088140.1.62211 WP_003088140.1.62357 WP_003088140.1.6242 WP_003088140.1.62516 WP_003088140.1.62534 WP_003088140.1.626 WP_003088140.1.62604 WP_003088140.1.62635 WP_003088140.1.62701 WP_003088140.1.62703 WP_003088140.1.62708 WP_003088140.1.62716 WP_003088140.1.62772 WP_003088140.1.6280 WP_003088140.1.62834 WP_003088140.1.62838 WP_003088140.1.62917 WP_003088140.1.62961 WP_003088140.1.62977 WP_003088140.1.63041 WP_003088140.1.63057 WP_003088140.1.63124 WP_003088140.1.63401 WP_003088140.1.63591 WP_003088140.1.63659 WP_003088140.1.63739 WP_003088140.1.63784 WP_003088140.1.63929 WP_003088140.1.63941 WP_003088140.1.63995 WP_003088140.1.64139 WP_003088140.1.64155 WP_003088140.1.64198 WP_003088140.1.64212 WP_003088140.1.64309 WP_003088140.1.64340 WP_003088140.1.64433 WP_003088140.1.6450 WP_003088140.1.64544 WP_003088140.1.64603 WP_003088140.1.64605 WP_003088140.1.6461 WP_003088140.1.64611 WP_003088140.1.64726 WP_003088140.1.64748 WP_003088140.1.64799 WP_003088140.1.64880 WP_003088140.1.64885 WP_003088140.1.64886 WP_003088140.1.64983 WP_003088140.1.65009 WP_003088140.1.65066 WP_003088140.1.65092 WP_003088140.1.65095 WP_003088140.1.65099 WP_003088140.1.65196 WP_003088140.1.65227 WP_003088140.1.65237 WP_003088140.1.65247 WP_003088140.1.65285 WP_003088140.1.65304 WP_003088140.1.65312 WP_003088140.1.65316 WP_003088140.1.65334 WP_003088140.1.65337 WP_003088140.1.65457 WP_003088140.1.65478 WP_003088140.1.65549 WP_003088140.1.65632 WP_003088140.1.65740 WP_003088140.1.65779 WP_003088140.1.65867 WP_003088140.1.6589 WP_003088140.1.66088 WP_003088140.1.66155 WP_003088140.1.66165 WP_003088140.1.6629 WP_003088140.1.66348 WP_003088140.1.66364 WP_003088140.1.66371 WP_003088140.1.66526 WP_003088140.1.66634 WP_003088140.1.66693 WP_003088140.1.66721 WP_003088140.1.66892 WP_003088140.1.66931 WP_003088140.1.66945 WP_003088140.1.66982 WP_003088140.1.67124 WP_003088140.1.67188 WP_003088140.1.67388 WP_003088140.1.67489 WP_003088140.1.67506 WP_003088140.1.67531 WP_003088140.1.67545 WP_003088140.1.67686 WP_003088140.1.67755 WP_003088140.1.67874 WP_003088140.1.67875 WP_003088140.1.67899 WP_003088140.1.67903 WP_003088140.1.67937 WP_003088140.1.67948 WP_003088140.1.6796 WP_003088140.1.68158 WP_003088140.1.68162 WP_003088140.1.68172 WP_003088140.1.68194 WP_003088140.1.68317 WP_003088140.1.68446 WP_003088140.1.68448 WP_003088140.1.68499 WP_003088140.1.68541 WP_003088140.1.68568 WP_003088140.1.68638 WP_003088140.1.68781 WP_003088140.1.68800 WP_003088140.1.68802 WP_003088140.1.68857 WP_003088140.1.68862 WP_003088140.1.68910 WP_003088140.1.68979 WP_003088140.1.6911 WP_003088140.1.69209 WP_003088140.1.6928 WP_003088140.1.6937 WP_003088140.1.69411 WP_003088140.1.69534 WP_003088140.1.69556 WP_003088140.1.69599 WP_003088140.1.69788 WP_003088140.1.69819 WP_003088140.1.69834 WP_003088140.1.70092 WP_003088140.1.70098 WP_003088140.1.70194 WP_003088140.1.70216 WP_003088140.1.70331 WP_003088140.1.70470 WP_003088140.1.70537 WP_003088140.1.70561 WP_003088140.1.70583 WP_003088140.1.70648 WP_003088140.1.70650 WP_003088140.1.70677 WP_003088140.1.70991 WP_003088140.1.71141 WP_003088140.1.71234 WP_003088140.1.71249 WP_003088140.1.71290 WP_003088140.1.71570 WP_003088140.1.71610 WP_003088140.1.7163 WP_003088140.1.71642 WP_003088140.1.71666 WP_003088140.1.71738 WP_003088140.1.71799 WP_003088140.1.71806 WP_003088140.1.71822 WP_003088140.1.71866 WP_003088140.1.71891 WP_003088140.1.71934 WP_003088140.1.72149 WP_003088140.1.72181 WP_003088140.1.7219 WP_003088140.1.72331 WP_003088140.1.72346 WP_003088140.1.72458 WP_003088140.1.72477 WP_003088140.1.72570 WP_003088140.1.72653 WP_003088140.1.72662 WP_003088140.1.72727 WP_003088140.1.72772 WP_003088140.1.72782 WP_003088140.1.72845 WP_003088140.1.72920 WP_003088140.1.73035 WP_003088140.1.7308 WP_003088140.1.73135 WP_003088140.1.73149 WP_003088140.1.73172 WP_003088140.1.73192 WP_003088140.1.73455 WP_003088140.1.73490 WP_003088140.1.73651 WP_003088140.1.73719 WP_003088140.1.73728 WP_003088140.1.7377 WP_003088140.1.73791 WP_003088140.1.73860 WP_003088140.1.73941 WP_003088140.1.74000 WP_003088140.1.74175 WP_003088140.1.74182 WP_003088140.1.74264 WP_003088140.1.74281 WP_003088140.1.74287 WP_003088140.1.74326 WP_003088140.1.7445 WP_003088140.1.7448 WP_003088140.1.7456 WP_003088140.1.74604 WP_003088140.1.74629 WP_003088140.1.74685 WP_003088140.1.74776 WP_003088140.1.74948 WP_003088140.1.74958 WP_003088140.1.7501 WP_003088140.1.75119 WP_003088140.1.75204 WP_003088140.1.75303 WP_003088140.1.75389 WP_003088140.1.75431 WP_003088140.1.7547 WP_003088140.1.75580 WP_003088140.1.75599 WP_003088140.1.75603 WP_003088140.1.75631 WP_003088140.1.7568 WP_003088140.1.75756 WP_003088140.1.75771 WP_003088140.1.75792 WP_003088140.1.75825 WP_003088140.1.75826 WP_003088140.1.75935 WP_003088140.1.75938 WP_003088140.1.75947 WP_003088140.1.76077 WP_003088140.1.76092 WP_003088140.1.76141 WP_003088140.1.76145 WP_003088140.1.76192 WP_003088140.1.76322 WP_003088140.1.76383 WP_003088140.1.76399 WP_003088140.1.76441 WP_003088140.1.76467 WP_003088140.1.76484 WP_003088140.1.76775 WP_003088140.1.77238 WP_003088140.1.77286 WP_003088140.1.77442 WP_003088140.1.77490 WP_003088140.1.77566 WP_003088140.1.77574 WP_003088140.1.77587 WP_003088140.1.77686 WP_003088140.1.77769 WP_003088140.1.7779 WP_003088140.1.77819 WP_003088140.1.78112 WP_003088140.1.78118 WP_003088140.1.78134 WP_003088140.1.78148 WP_003088140.1.78288 WP_003088140.1.78380 WP_003088140.1.7840 WP_003088140.1.78409 WP_003088140.1.78430 WP_003088140.1.78437 WP_003088140.1.78599 WP_003088140.1.78623 WP_003088140.1.78795 WP_003088140.1.788 WP_003088140.1.78810 WP_003088140.1.78986 WP_003088140.1.79003 WP_003088140.1.79007 WP_003088140.1.79053 WP_003088140.1.79060 WP_003088140.1.79177 WP_003088140.1.79256 WP_003088140.1.79364 WP_003088140.1.79421 WP_003088140.1.79429 WP_003088140.1.79431 WP_003088140.1.7945 WP_003088140.1.79463 WP_003088140.1.79507 WP_003088140.1.79544 WP_003088140.1.79601 WP_003088140.1.79631 WP_003088140.1.79754 WP_003088140.1.79862 WP_003088140.1.799 WP_003088140.1.79902 WP_003088140.1.79908 WP_003088140.1.80033 WP_003088140.1.80087 WP_003088140.1.80102 WP_003088140.1.80174 WP_003088140.1.8028 WP_003088140.1.8038 WP_003088140.1.80454 WP_003088140.1.80481 WP_003088140.1.8051 WP_003088140.1.80535 WP_003088140.1.80572 WP_003088140.1.80632 WP_003088140.1.80645 WP_003088140.1.80683 WP_003088140.1.80715 WP_003088140.1.80785 WP_003088140.1.80846 WP_003088140.1.80880 WP_003088140.1.80910 WP_003088140.1.80926 WP_003088140.1.80931 WP_003088140.1.80938 WP_003088140.1.80969 WP_003088140.1.81081 WP_003088140.1.81082 WP_003088140.1.81206 WP_003088140.1.81331 WP_003088140.1.81338 WP_003088140.1.81349 WP_003088140.1.81368 WP_003088140.1.81380 WP_003088140.1.8141 WP_003088140.1.81426 WP_003088140.1.81470 WP_003088140.1.81482 WP_003088140.1.81581 WP_003088140.1.81591 WP_003088140.1.81643 WP_003088140.1.81708 WP_003088140.1.81742 WP_003088140.1.81771 WP_003088140.1.81784 WP_003088140.1.81802 WP_003088140.1.81816 WP_003088140.1.81834 WP_003088140.1.81856 WP_003088140.1.81874 WP_003088140.1.81927 WP_003088140.1.81957 WP_003088140.1.81960 WP_003088140.1.81986 WP_003088140.1.82310 WP_003088140.1.82328 WP_003088140.1.82334 WP_003088140.1.82604 WP_003088140.1.82606 WP_003088140.1.82620 WP_003088140.1.82643 WP_003088140.1.82686 WP_003088140.1.82798 WP_003088140.1.82810 WP_003088140.1.8284 WP_003088140.1.82864 WP_003088140.1.82936 WP_003088140.1.83131 WP_003088140.1.83213 WP_003088140.1.83267 WP_003088140.1.83317 WP_003088140.1.83374 WP_003088140.1.83440 WP_003088140.1.83460 WP_003088140.1.83503 WP_003088140.1.8351 WP_003088140.1.8353 WP_003088140.1.83534 WP_003088140.1.83540 WP_003088140.1.8357 WP_003088140.1.83637 WP_003088140.1.83673 WP_003088140.1.83698 WP_003088140.1.83715 WP_003088140.1.83871 WP_003088140.1.83937 WP_003088140.1.83946 WP_003088140.1.84003 WP_003088140.1.84138 WP_003088140.1.84177 WP_003088140.1.84203 WP_003088140.1.8437 WP_003088140.1.84374 WP_003088140.1.84404 WP_003088140.1.84439 WP_003088140.1.84471 WP_003088140.1.84538 WP_003088140.1.84558 WP_003088140.1.84684 WP_003088140.1.84715 WP_003088140.1.84754 WP_003088140.1.84792 WP_003088140.1.84825 WP_003088140.1.8484 WP_003088140.1.84865 WP_003088140.1.84937 WP_003088140.1.84946 WP_003088140.1.8498 WP_003088140.1.85018 WP_003088140.1.85028 WP_003088140.1.85059 WP_003088140.1.85150 WP_003088140.1.85220 WP_003088140.1.85290 WP_003088140.1.85303 WP_003088140.1.85311 WP_003088140.1.85453 WP_003088140.1.85574 WP_003088140.1.85633 WP_003088140.1.85638 WP_003088140.1.85788 WP_003088140.1.85910 WP_003088140.1.85920 WP_003088140.1.85978 WP_003088140.1.86002 WP_003088140.1.86047 WP_003088140.1.861 WP_003088140.1.86125 WP_003088140.1.86182 WP_003088140.1.86243 WP_003088140.1.86287 WP_003088140.1.86293 WP_003088140.1.86386 WP_003088140.1.86432 WP_003088140.1.8645 WP_003088140.1.865 WP_003088140.1.86506 WP_003088140.1.86545 WP_003088140.1.86595 WP_003088140.1.86652 WP_003088140.1.86665 WP_003088140.1.867 WP_003088140.1.86708 WP_003088140.1.86733 WP_003088140.1.86796 WP_003088140.1.86813 WP_003088140.1.86822 WP_003088140.1.8693 WP_003088140.1.86947 WP_003088140.1.86970 WP_003088140.1.87104 WP_003088140.1.87182 WP_003088140.1.8727 WP_003088140.1.87390 WP_003088140.1.87435 WP_003088140.1.8749 WP_003088140.1.87547 WP_003088140.1.87648 WP_003088140.1.87763 WP_003088140.1.8777 WP_003088140.1.8785 WP_003088140.1.87888 WP_003088140.1.87970 WP_003088140.1.87975 WP_003088140.1.87987 WP_003088140.1.88152 WP_003088140.1.88308 WP_003088140.1.88388 WP_003088140.1.88517 WP_003088140.1.88540 WP_003088140.1.88550 WP_003088140.1.88578 WP_003088140.1.88659 WP_003088140.1.88679 WP_003088140.1.88680 WP_003088140.1.88750 WP_003088140.1.88796 WP_003088140.1.889 WP_003088140.1.88900 WP_003088140.1.88949 WP_003088140.1.89098 WP_003088140.1.8911 WP_003088140.1.89234 WP_003088140.1.89266 WP_003088140.1.89276 WP_003088140.1.89330 WP_003088140.1.89409 WP_003088140.1.89434 WP_003088140.1.89440 WP_003088140.1.89480 WP_003088140.1.8949 WP_003088140.1.89491 WP_003088140.1.89523 WP_003088140.1.89638 WP_003088140.1.89669 WP_003088140.1.8976 WP_003088140.1.89867 WP_003088140.1.89868 WP_003088140.1.89871 WP_003088140.1.90024 WP_003088140.1.90032 WP_003088140.1.90150 WP_003088140.1.90189 WP_003088140.1.90224 WP_003088140.1.90225 WP_003088140.1.90272 WP_003088140.1.9056 WP_003088140.1.90655 WP_003088140.1.90770 WP_003088140.1.90940 WP_003088140.1.91012 WP_003088140.1.91236 WP_003088140.1.91281 WP_003088140.1.91307 WP_003088140.1.91360 WP_003088140.1.91392 WP_003088140.1.91416 WP_003088140.1.91431 WP_003088140.1.91438 WP_003088140.1.91527 WP_003088140.1.91563 WP_003088140.1.91585 WP_003088140.1.9182 WP_003088140.1.91860 WP_003088140.1.91862 WP_003088140.1.91882 WP_003088140.1.9191 WP_003088140.1.92043 WP_003088140.1.92175 WP_003088140.1.92314 WP_003088140.1.92321 WP_003088140.1.92357 WP_003088140.1.92585 WP_003088140.1.92587 WP_003088140.1.92589 WP_003088140.1.92594 WP_003088140.1.92624 WP_003088140.1.92630 WP_003088140.1.9272 WP_003088140.1.92759 WP_003088140.1.92769 WP_003088140.1.92839 WP_003088140.1.92847 WP_003088140.1.92894 WP_003088140.1.92924 WP_003088140.1.92930 WP_003088140.1.93001 WP_003088140.1.93090 WP_003088140.1.93122 WP_003088140.1.93144 WP_003088140.1.93196 WP_003088140.1.93250 WP_003088140.1.93264 WP_003088140.1.93446 WP_003088140.1.9349 WP_003088140.1.93493 WP_003088140.1.93520 WP_003088140.1.93568 WP_003088140.1.93848 WP_003088140.1.93889 WP_003088140.1.93897 WP_003088140.1.94065 WP_003088140.1.94078 WP_003088140.1.94174 WP_003088140.1.94230 WP_003088140.1.94243 WP_003088140.1.94285 WP_003088140.1.94288 WP_003088140.1.94333 WP_003088140.1.94349 WP_003088140.1.94385 WP_003088140.1.94422 WP_003088140.1.94434 WP_003088140.1.9444 WP_003088140.1.94450 WP_003088140.1.94732 WP_003088140.1.94814 WP_003088140.1.94818 WP_003088140.1.94874 WP_003088140.1.94881 WP_003088140.1.94896 WP_003088140.1.94897 WP_003088140.1.94943 WP_003088140.1.95018 WP_003088140.1.95025 WP_003088140.1.95132 WP_003088140.1.95207 WP_003088140.1.95305 WP_003088140.1.95324 WP_003088140.1.95354 WP_003088140.1.95460 WP_003088140.1.95488 WP_003088140.1.95536 WP_003088140.1.95668 WP_003088140.1.95745 WP_003088140.1.95751 WP_003088140.1.95774 WP_003088140.1.95782 WP_003088140.1.95787 WP_003088140.1.95802 WP_003088140.1.95959 WP_003088140.1.95994 WP_003088140.1.95999 WP_003088140.1.96008 WP_003088140.1.9604 WP_003088140.1.96041 WP_003088140.1.96058 WP_003088140.1.961 WP_003088140.1.96134 WP_003088140.1.96357 WP_003088140.1.96434 WP_003088140.1.96506 WP_003088140.1.96667 WP_003088140.1.96702 WP_003088140.1.96863 WP_003088140.1.96880 WP_003088140.1.96967 WP_003088140.1.97126 WP_003088140.1.97204 WP_003088140.1.9722 WP_003088140.1.97377 WP_003088140.1.97461 WP_003088140.1.97488 WP_003088140.1.97499 WP_003088140.1.97503 WP_003088140.1.97583 WP_003088140.1.97784 WP_003088140.1.97826 WP_003088140.1.97877 WP_003088140.1.98111 WP_003088140.1.98260 WP_003088140.1.98276 WP_003088140.1.98308 WP_003088140.1.98433 WP_003088140.1.9845 WP_003088140.1.985 WP_003088140.1.98600 WP_003088140.1.98672 WP_003088140.1.98678 WP_003088140.1.98693 WP_003088140.1.98718 WP_003088140.1.98788 WP_003088140.1.98814 WP_003088140.1.9885 WP_003088140.1.98873 WP_003088140.1.98926 WP_003088140.1.98958 WP_003088140.1.98960 WP_003088140.1.98963 WP_003088140.1.99065 WP_003088140.1.99103 WP_003088140.1.99214 WP_003088140.1.99293 WP_003088140.1.99353 WP_003088140.1.99378 WP_003088140.1.99386 WP_003088140.1.99443 WP_003088140.1.99461 WP_003088140.1.9951 WP_003088140.1.99654 WP_003088140.1.99662 WP_003088140.1.99746 WP_003088140.1.99757 WP_003088140.1.99772 WP_003088140.1.99835 WP_003088140.1.9989 WP_003088140.1.99930 gi|564953123|ref|YP_008885693.1| gi|568154581|ref|YP_008943563.1| gi|558671404|ref|YP_008808114.1| gi|514409294|ref|YP_008132413.1| gi|558677755|ref|YP_008814463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]