SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154821|ref|YP_008943805.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154821|ref|YP_008943805.1|
Domain Number 1 Region: 77-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568154821|ref|YP_008943805.1|
Sequence length 200
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MYKVYGDYRSGNCYKIKLAMSLLGIDYQWVPVDILKGETQTPEFLAKNPNGKIPVLELED
GSCLWESNAILNFLADGSALLPSEPRLRTQVLQWQFFEQYSHEPYVAVARFIKLYLGLPE
ARRAEFEEKKIGGYKALDVMEKQLSRTPFLVGEQFSIADITLYAYTHVAHEGGFDLTAYP
AIRAWIKRVGEVPGYVGMLD
Download sequence
Identical sequences A0A0C7CYC4 A0A0H2Z9L7 A0A157WTP0 A0A1E9BUZ2 A0A1F0I0K0 A0A1G5GH83 A0A1S1BZW3 Q9I370
gi|392984880|ref|YP_006483467.1| gi|15596852|ref|NP_250346.1| gi|218892390|ref|YP_002441257.1| gi|558671126|ref|YP_008807836.1| gi|558677477|ref|YP_008814185.1| 208963.PA14_43110 208964.PA1655 557722.PLES_36721 gi|386059454|ref|YP_005975976.1| NP_250346.1.87394 WP_003097816.1.100071 WP_003097816.1.100100 WP_003097816.1.100276 WP_003097816.1.100278 WP_003097816.1.100319 WP_003097816.1.100420 WP_003097816.1.100456 WP_003097816.1.100473 WP_003097816.1.100476 WP_003097816.1.100523 WP_003097816.1.100654 WP_003097816.1.100742 WP_003097816.1.100786 WP_003097816.1.100810 WP_003097816.1.100872 WP_003097816.1.100995 WP_003097816.1.101047 WP_003097816.1.101269 WP_003097816.1.101310 WP_003097816.1.101572 WP_003097816.1.101712 WP_003097816.1.101739 WP_003097816.1.10179 WP_003097816.1.101809 WP_003097816.1.101819 WP_003097816.1.101863 WP_003097816.1.10201 WP_003097816.1.10202 WP_003097816.1.10204 WP_003097816.1.102045 WP_003097816.1.10228 WP_003097816.1.10248 WP_003097816.1.10257 WP_003097816.1.10419 WP_003097816.1.10435 WP_003097816.1.10457 WP_003097816.1.10468 WP_003097816.1.10477 WP_003097816.1.10482 WP_003097816.1.10513 WP_003097816.1.10529 WP_003097816.1.10572 WP_003097816.1.10575 WP_003097816.1.10641 WP_003097816.1.10684 WP_003097816.1.10764 WP_003097816.1.10895 WP_003097816.1.10901 WP_003097816.1.11026 WP_003097816.1.11058 WP_003097816.1.1107 WP_003097816.1.11077 WP_003097816.1.1109 WP_003097816.1.11163 WP_003097816.1.11180 WP_003097816.1.11318 WP_003097816.1.11381 WP_003097816.1.11410 WP_003097816.1.11417 WP_003097816.1.11454 WP_003097816.1.11568 WP_003097816.1.11569 WP_003097816.1.11653 WP_003097816.1.11744 WP_003097816.1.1180 WP_003097816.1.11847 WP_003097816.1.1187 WP_003097816.1.11943 WP_003097816.1.12081 WP_003097816.1.12120 WP_003097816.1.12150 WP_003097816.1.12200 WP_003097816.1.12208 WP_003097816.1.12240 WP_003097816.1.12302 WP_003097816.1.12354 WP_003097816.1.12482 WP_003097816.1.12497 WP_003097816.1.12547 WP_003097816.1.12561 WP_003097816.1.12670 WP_003097816.1.12687 WP_003097816.1.12797 WP_003097816.1.12838 WP_003097816.1.12873 WP_003097816.1.12891 WP_003097816.1.12930 WP_003097816.1.12934 WP_003097816.1.12970 WP_003097816.1.12980 WP_003097816.1.13 WP_003097816.1.1305 WP_003097816.1.13057 WP_003097816.1.13085 WP_003097816.1.13092 WP_003097816.1.13208 WP_003097816.1.13232 WP_003097816.1.13266 WP_003097816.1.13315 WP_003097816.1.1333 WP_003097816.1.13407 WP_003097816.1.13529 WP_003097816.1.13533 WP_003097816.1.1356 WP_003097816.1.1362 WP_003097816.1.13622 WP_003097816.1.13718 WP_003097816.1.13743 WP_003097816.1.13758 WP_003097816.1.13765 WP_003097816.1.13785 WP_003097816.1.13795 WP_003097816.1.13828 WP_003097816.1.1393 WP_003097816.1.14078 WP_003097816.1.14096 WP_003097816.1.14204 WP_003097816.1.14251 WP_003097816.1.14378 WP_003097816.1.14424 WP_003097816.1.14455 WP_003097816.1.14460 WP_003097816.1.14525 WP_003097816.1.14564 WP_003097816.1.14640 WP_003097816.1.14714 WP_003097816.1.1475 WP_003097816.1.14815 WP_003097816.1.14820 WP_003097816.1.14835 WP_003097816.1.14839 WP_003097816.1.14966 WP_003097816.1.14981 WP_003097816.1.15004 WP_003097816.1.15130 WP_003097816.1.1516 WP_003097816.1.152 WP_003097816.1.15222 WP_003097816.1.15231 WP_003097816.1.15281 WP_003097816.1.15328 WP_003097816.1.15373 WP_003097816.1.15379 WP_003097816.1.15474 WP_003097816.1.15482 WP_003097816.1.15485 WP_003097816.1.15602 WP_003097816.1.15692 WP_003097816.1.15886 WP_003097816.1.15889 WP_003097816.1.16041 WP_003097816.1.16109 WP_003097816.1.16161 WP_003097816.1.16197 WP_003097816.1.162 WP_003097816.1.16239 WP_003097816.1.16242 WP_003097816.1.16267 WP_003097816.1.16279 WP_003097816.1.16419 WP_003097816.1.1646 WP_003097816.1.16694 WP_003097816.1.1670 WP_003097816.1.1671 WP_003097816.1.16751 WP_003097816.1.16782 WP_003097816.1.16788 WP_003097816.1.16801 WP_003097816.1.16808 WP_003097816.1.16811 WP_003097816.1.16895 WP_003097816.1.17022 WP_003097816.1.1704 WP_003097816.1.17108 WP_003097816.1.17155 WP_003097816.1.17162 WP_003097816.1.17177 WP_003097816.1.17223 WP_003097816.1.17353 WP_003097816.1.17354 WP_003097816.1.17370 WP_003097816.1.1739 WP_003097816.1.17566 WP_003097816.1.1758 WP_003097816.1.17697 WP_003097816.1.17883 WP_003097816.1.17890 WP_003097816.1.18052 WP_003097816.1.18054 WP_003097816.1.18117 WP_003097816.1.18156 WP_003097816.1.18157 WP_003097816.1.18204 WP_003097816.1.18234 WP_003097816.1.1824 WP_003097816.1.18349 WP_003097816.1.18440 WP_003097816.1.18493 WP_003097816.1.18508 WP_003097816.1.18547 WP_003097816.1.18653 WP_003097816.1.18728 WP_003097816.1.18735 WP_003097816.1.18769 WP_003097816.1.18852 WP_003097816.1.18907 WP_003097816.1.18930 WP_003097816.1.190 WP_003097816.1.19089 WP_003097816.1.19199 WP_003097816.1.19251 WP_003097816.1.19260 WP_003097816.1.19269 WP_003097816.1.19346 WP_003097816.1.19351 WP_003097816.1.19552 WP_003097816.1.19591 WP_003097816.1.19640 WP_003097816.1.19703 WP_003097816.1.1971 WP_003097816.1.19711 WP_003097816.1.19718 WP_003097816.1.19741 WP_003097816.1.19771 WP_003097816.1.19930 WP_003097816.1.19931 WP_003097816.1.20024 WP_003097816.1.20070 WP_003097816.1.2012 WP_003097816.1.20125 WP_003097816.1.20134 WP_003097816.1.20342 WP_003097816.1.20682 WP_003097816.1.20692 WP_003097816.1.20744 WP_003097816.1.20764 WP_003097816.1.20825 WP_003097816.1.20854 WP_003097816.1.20880 WP_003097816.1.20884 WP_003097816.1.20890 WP_003097816.1.209 WP_003097816.1.20929 WP_003097816.1.21039 WP_003097816.1.21096 WP_003097816.1.21209 WP_003097816.1.21242 WP_003097816.1.21302 WP_003097816.1.21349 WP_003097816.1.21358 WP_003097816.1.21448 WP_003097816.1.21469 WP_003097816.1.21471 WP_003097816.1.21517 WP_003097816.1.21607 WP_003097816.1.2172 WP_003097816.1.21744 WP_003097816.1.21767 WP_003097816.1.21801 WP_003097816.1.21863 WP_003097816.1.21871 WP_003097816.1.21891 WP_003097816.1.21932 WP_003097816.1.22078 WP_003097816.1.221 WP_003097816.1.22324 WP_003097816.1.22389 WP_003097816.1.22394 WP_003097816.1.22442 WP_003097816.1.22477 WP_003097816.1.22491 WP_003097816.1.22573 WP_003097816.1.22704 WP_003097816.1.22729 WP_003097816.1.22863 WP_003097816.1.2289 WP_003097816.1.22891 WP_003097816.1.23013 WP_003097816.1.23195 WP_003097816.1.23264 WP_003097816.1.23331 WP_003097816.1.23394 WP_003097816.1.23418 WP_003097816.1.23512 WP_003097816.1.23518 WP_003097816.1.23523 WP_003097816.1.23525 WP_003097816.1.2355 WP_003097816.1.23559 WP_003097816.1.23581 WP_003097816.1.23611 WP_003097816.1.23641 WP_003097816.1.23715 WP_003097816.1.23739 WP_003097816.1.2374 WP_003097816.1.23769 WP_003097816.1.23782 WP_003097816.1.23794 WP_003097816.1.23884 WP_003097816.1.23925 WP_003097816.1.23938 WP_003097816.1.23961 WP_003097816.1.23967 WP_003097816.1.23983 WP_003097816.1.24066 WP_003097816.1.24077 WP_003097816.1.24087 WP_003097816.1.24101 WP_003097816.1.24234 WP_003097816.1.24319 WP_003097816.1.24351 WP_003097816.1.24382 WP_003097816.1.24413 WP_003097816.1.24447 WP_003097816.1.2453 WP_003097816.1.24662 WP_003097816.1.2477 WP_003097816.1.24851 WP_003097816.1.24879 WP_003097816.1.24938 WP_003097816.1.24940 WP_003097816.1.25033 WP_003097816.1.25052 WP_003097816.1.25067 WP_003097816.1.25075 WP_003097816.1.251 WP_003097816.1.25109 WP_003097816.1.2511 WP_003097816.1.25142 WP_003097816.1.25149 WP_003097816.1.25179 WP_003097816.1.25271 WP_003097816.1.2530 WP_003097816.1.25348 WP_003097816.1.2535 WP_003097816.1.25532 WP_003097816.1.25695 WP_003097816.1.2572 WP_003097816.1.2596 WP_003097816.1.25964 WP_003097816.1.26010 WP_003097816.1.26025 WP_003097816.1.26042 WP_003097816.1.261 WP_003097816.1.26159 WP_003097816.1.26334 WP_003097816.1.26428 WP_003097816.1.26463 WP_003097816.1.26473 WP_003097816.1.26489 WP_003097816.1.2652 WP_003097816.1.26539 WP_003097816.1.26553 WP_003097816.1.26592 WP_003097816.1.26604 WP_003097816.1.26681 WP_003097816.1.26682 WP_003097816.1.26705 WP_003097816.1.26740 WP_003097816.1.26816 WP_003097816.1.26862 WP_003097816.1.26906 WP_003097816.1.26967 WP_003097816.1.2698 WP_003097816.1.27018 WP_003097816.1.27028 WP_003097816.1.27073 WP_003097816.1.27211 WP_003097816.1.27218 WP_003097816.1.27259 WP_003097816.1.27505 WP_003097816.1.27534 WP_003097816.1.27575 WP_003097816.1.27587 WP_003097816.1.27687 WP_003097816.1.27738 WP_003097816.1.27837 WP_003097816.1.27858 WP_003097816.1.27933 WP_003097816.1.27939 WP_003097816.1.28006 WP_003097816.1.28057 WP_003097816.1.28064 WP_003097816.1.28136 WP_003097816.1.28175 WP_003097816.1.28193 WP_003097816.1.28258 WP_003097816.1.28316 WP_003097816.1.28329 WP_003097816.1.28372 WP_003097816.1.28382 WP_003097816.1.28383 WP_003097816.1.28404 WP_003097816.1.28468 WP_003097816.1.28528 WP_003097816.1.28602 WP_003097816.1.28623 WP_003097816.1.28713 WP_003097816.1.28757 WP_003097816.1.28800 WP_003097816.1.28823 WP_003097816.1.28838 WP_003097816.1.28849 WP_003097816.1.28920 WP_003097816.1.29062 WP_003097816.1.29096 WP_003097816.1.29137 WP_003097816.1.29179 WP_003097816.1.29208 WP_003097816.1.2927 WP_003097816.1.29401 WP_003097816.1.29438 WP_003097816.1.29440 WP_003097816.1.29472 WP_003097816.1.2948 WP_003097816.1.29498 WP_003097816.1.29501 WP_003097816.1.29577 WP_003097816.1.2961 WP_003097816.1.29633 WP_003097816.1.29753 WP_003097816.1.29767 WP_003097816.1.2980 WP_003097816.1.29848 WP_003097816.1.29958 WP_003097816.1.29973 WP_003097816.1.30000 WP_003097816.1.30081 WP_003097816.1.30120 WP_003097816.1.30254 WP_003097816.1.30563 WP_003097816.1.30567 WP_003097816.1.30614 WP_003097816.1.30615 WP_003097816.1.30625 WP_003097816.1.30693 WP_003097816.1.30707 WP_003097816.1.3072 WP_003097816.1.30886 WP_003097816.1.30943 WP_003097816.1.30973 WP_003097816.1.30994 WP_003097816.1.31045 WP_003097816.1.31076 WP_003097816.1.31087 WP_003097816.1.31103 WP_003097816.1.31105 WP_003097816.1.31138 WP_003097816.1.31147 WP_003097816.1.31279 WP_003097816.1.31361 WP_003097816.1.31457 WP_003097816.1.31501 WP_003097816.1.31563 WP_003097816.1.31565 WP_003097816.1.31655 WP_003097816.1.3172 WP_003097816.1.31732 WP_003097816.1.31741 WP_003097816.1.3179 WP_003097816.1.31848 WP_003097816.1.31852 WP_003097816.1.3189 WP_003097816.1.31939 WP_003097816.1.32137 WP_003097816.1.32144 WP_003097816.1.32289 WP_003097816.1.32314 WP_003097816.1.32359 WP_003097816.1.32447 WP_003097816.1.32544 WP_003097816.1.32596 WP_003097816.1.32637 WP_003097816.1.32641 WP_003097816.1.32711 WP_003097816.1.32821 WP_003097816.1.32869 WP_003097816.1.32879 WP_003097816.1.32998 WP_003097816.1.33047 WP_003097816.1.33097 WP_003097816.1.33133 WP_003097816.1.33152 WP_003097816.1.33186 WP_003097816.1.33204 WP_003097816.1.33210 WP_003097816.1.33216 WP_003097816.1.33294 WP_003097816.1.33340 WP_003097816.1.33387 WP_003097816.1.33438 WP_003097816.1.33441 WP_003097816.1.33455 WP_003097816.1.3351 WP_003097816.1.33517 WP_003097816.1.33521 WP_003097816.1.33523 WP_003097816.1.33547 WP_003097816.1.33653 WP_003097816.1.33658 WP_003097816.1.33669 WP_003097816.1.33733 WP_003097816.1.3376 WP_003097816.1.33774 WP_003097816.1.33822 WP_003097816.1.33833 WP_003097816.1.3385 WP_003097816.1.34000 WP_003097816.1.34039 WP_003097816.1.34136 WP_003097816.1.34151 WP_003097816.1.34191 WP_003097816.1.34203 WP_003097816.1.34306 WP_003097816.1.34401 WP_003097816.1.34402 WP_003097816.1.34465 WP_003097816.1.34472 WP_003097816.1.3452 WP_003097816.1.34556 WP_003097816.1.34568 WP_003097816.1.34583 WP_003097816.1.34625 WP_003097816.1.34670 WP_003097816.1.34689 WP_003097816.1.34784 WP_003097816.1.34821 WP_003097816.1.34832 WP_003097816.1.34836 WP_003097816.1.34837 WP_003097816.1.34878 WP_003097816.1.34901 WP_003097816.1.35036 WP_003097816.1.35104 WP_003097816.1.35149 WP_003097816.1.35231 WP_003097816.1.35281 WP_003097816.1.3531 WP_003097816.1.35325 WP_003097816.1.35431 WP_003097816.1.35442 WP_003097816.1.35480 WP_003097816.1.35573 WP_003097816.1.35599 WP_003097816.1.35639 WP_003097816.1.35641 WP_003097816.1.35669 WP_003097816.1.35679 WP_003097816.1.35682 WP_003097816.1.3576 WP_003097816.1.35762 WP_003097816.1.35768 WP_003097816.1.35822 WP_003097816.1.35843 WP_003097816.1.35857 WP_003097816.1.35872 WP_003097816.1.35968 WP_003097816.1.35984 WP_003097816.1.36064 WP_003097816.1.36170 WP_003097816.1.36266 WP_003097816.1.36267 WP_003097816.1.36378 WP_003097816.1.36435 WP_003097816.1.36521 WP_003097816.1.3653 WP_003097816.1.36587 WP_003097816.1.36630 WP_003097816.1.36665 WP_003097816.1.36756 WP_003097816.1.36781 WP_003097816.1.36879 WP_003097816.1.37050 WP_003097816.1.37097 WP_003097816.1.37125 WP_003097816.1.37163 WP_003097816.1.37208 WP_003097816.1.3721 WP_003097816.1.37216 WP_003097816.1.373 WP_003097816.1.37319 WP_003097816.1.37416 WP_003097816.1.37500 WP_003097816.1.37512 WP_003097816.1.37571 WP_003097816.1.37698 WP_003097816.1.37703 WP_003097816.1.3773 WP_003097816.1.37799 WP_003097816.1.3781 WP_003097816.1.37814 WP_003097816.1.37826 WP_003097816.1.37842 WP_003097816.1.3785 WP_003097816.1.3792 WP_003097816.1.38003 WP_003097816.1.38023 WP_003097816.1.38087 WP_003097816.1.38102 WP_003097816.1.38146 WP_003097816.1.38151 WP_003097816.1.38186 WP_003097816.1.3821 WP_003097816.1.38319 WP_003097816.1.3833 WP_003097816.1.38430 WP_003097816.1.38450 WP_003097816.1.38502 WP_003097816.1.38505 WP_003097816.1.38583 WP_003097816.1.38587 WP_003097816.1.38657 WP_003097816.1.38661 WP_003097816.1.3870 WP_003097816.1.38706 WP_003097816.1.38816 WP_003097816.1.38889 WP_003097816.1.38932 WP_003097816.1.38971 WP_003097816.1.39046 WP_003097816.1.39088 WP_003097816.1.39186 WP_003097816.1.39271 WP_003097816.1.39326 WP_003097816.1.39345 WP_003097816.1.39444 WP_003097816.1.39452 WP_003097816.1.39458 WP_003097816.1.39704 WP_003097816.1.39765 WP_003097816.1.39786 WP_003097816.1.39811 WP_003097816.1.39949 WP_003097816.1.3998 WP_003097816.1.39989 WP_003097816.1.40059 WP_003097816.1.40115 WP_003097816.1.40135 WP_003097816.1.40207 WP_003097816.1.40213 WP_003097816.1.40237 WP_003097816.1.40243 WP_003097816.1.4038 WP_003097816.1.40419 WP_003097816.1.40442 WP_003097816.1.40512 WP_003097816.1.40541 WP_003097816.1.40546 WP_003097816.1.4058 WP_003097816.1.40874 WP_003097816.1.40950 WP_003097816.1.40984 WP_003097816.1.40994 WP_003097816.1.41110 WP_003097816.1.41290 WP_003097816.1.41291 WP_003097816.1.41301 WP_003097816.1.41384 WP_003097816.1.41412 WP_003097816.1.41429 WP_003097816.1.41502 WP_003097816.1.4156 WP_003097816.1.41618 WP_003097816.1.41625 WP_003097816.1.41692 WP_003097816.1.41732 WP_003097816.1.41748 WP_003097816.1.41773 WP_003097816.1.41832 WP_003097816.1.41846 WP_003097816.1.41871 WP_003097816.1.41888 WP_003097816.1.4190 WP_003097816.1.42019 WP_003097816.1.42041 WP_003097816.1.42146 WP_003097816.1.42294 WP_003097816.1.42316 WP_003097816.1.42381 WP_003097816.1.42388 WP_003097816.1.42463 WP_003097816.1.42499 WP_003097816.1.42508 WP_003097816.1.42634 WP_003097816.1.42643 WP_003097816.1.42754 WP_003097816.1.42757 WP_003097816.1.42778 WP_003097816.1.42789 WP_003097816.1.42854 WP_003097816.1.42856 WP_003097816.1.42870 WP_003097816.1.42917 WP_003097816.1.42946 WP_003097816.1.42952 WP_003097816.1.43024 WP_003097816.1.43026 WP_003097816.1.43049 WP_003097816.1.43106 WP_003097816.1.43245 WP_003097816.1.43286 WP_003097816.1.43293 WP_003097816.1.43330 WP_003097816.1.43356 WP_003097816.1.4348 WP_003097816.1.43603 WP_003097816.1.43662 WP_003097816.1.43667 WP_003097816.1.43673 WP_003097816.1.43696 WP_003097816.1.43729 WP_003097816.1.43756 WP_003097816.1.43802 WP_003097816.1.4381 WP_003097816.1.43826 WP_003097816.1.4398 WP_003097816.1.43998 WP_003097816.1.44094 WP_003097816.1.44213 WP_003097816.1.44260 WP_003097816.1.44373 WP_003097816.1.44434 WP_003097816.1.44486 WP_003097816.1.445 WP_003097816.1.44581 WP_003097816.1.44725 WP_003097816.1.44739 WP_003097816.1.44760 WP_003097816.1.4493 WP_003097816.1.44959 WP_003097816.1.45090 WP_003097816.1.45146 WP_003097816.1.45199 WP_003097816.1.45202 WP_003097816.1.45306 WP_003097816.1.45312 WP_003097816.1.4532 WP_003097816.1.45328 WP_003097816.1.45353 WP_003097816.1.45358 WP_003097816.1.45464 WP_003097816.1.45478 WP_003097816.1.45485 WP_003097816.1.45604 WP_003097816.1.45636 WP_003097816.1.45700 WP_003097816.1.45711 WP_003097816.1.45723 WP_003097816.1.45818 WP_003097816.1.45920 WP_003097816.1.45934 WP_003097816.1.46010 WP_003097816.1.46032 WP_003097816.1.461 WP_003097816.1.46152 WP_003097816.1.46200 WP_003097816.1.46306 WP_003097816.1.46436 WP_003097816.1.46502 WP_003097816.1.46623 WP_003097816.1.46755 WP_003097816.1.46826 WP_003097816.1.46885 WP_003097816.1.46926 WP_003097816.1.46935 WP_003097816.1.4699 WP_003097816.1.47101 WP_003097816.1.47155 WP_003097816.1.47158 WP_003097816.1.4726 WP_003097816.1.47296 WP_003097816.1.47312 WP_003097816.1.47374 WP_003097816.1.47469 WP_003097816.1.47480 WP_003097816.1.47645 WP_003097816.1.47774 WP_003097816.1.47930 WP_003097816.1.47970 WP_003097816.1.48001 WP_003097816.1.48086 WP_003097816.1.48172 WP_003097816.1.48178 WP_003097816.1.48321 WP_003097816.1.48334 WP_003097816.1.4836 WP_003097816.1.48378 WP_003097816.1.48382 WP_003097816.1.48413 WP_003097816.1.48472 WP_003097816.1.48474 WP_003097816.1.48487 WP_003097816.1.48545 WP_003097816.1.48546 WP_003097816.1.48576 WP_003097816.1.48810 WP_003097816.1.48820 WP_003097816.1.48842 WP_003097816.1.48851 WP_003097816.1.49108 WP_003097816.1.49265 WP_003097816.1.49266 WP_003097816.1.49286 WP_003097816.1.49293 WP_003097816.1.49360 WP_003097816.1.49416 WP_003097816.1.49500 WP_003097816.1.49557 WP_003097816.1.49688 WP_003097816.1.49798 WP_003097816.1.49806 WP_003097816.1.49833 WP_003097816.1.49842 WP_003097816.1.49922 WP_003097816.1.49988 WP_003097816.1.49998 WP_003097816.1.50176 WP_003097816.1.50180 WP_003097816.1.50232 WP_003097816.1.50242 WP_003097816.1.5043 WP_003097816.1.50653 WP_003097816.1.50665 WP_003097816.1.50668 WP_003097816.1.50682 WP_003097816.1.50734 WP_003097816.1.50814 WP_003097816.1.50967 WP_003097816.1.50989 WP_003097816.1.51019 WP_003097816.1.51035 WP_003097816.1.51136 WP_003097816.1.51141 WP_003097816.1.51183 WP_003097816.1.51185 WP_003097816.1.51267 WP_003097816.1.5132 WP_003097816.1.51457 WP_003097816.1.51472 WP_003097816.1.51501 WP_003097816.1.51538 WP_003097816.1.51549 WP_003097816.1.51585 WP_003097816.1.51682 WP_003097816.1.51807 WP_003097816.1.51847 WP_003097816.1.51889 WP_003097816.1.51937 WP_003097816.1.51957 WP_003097816.1.51976 WP_003097816.1.52043 WP_003097816.1.52212 WP_003097816.1.52220 WP_003097816.1.52244 WP_003097816.1.52326 WP_003097816.1.52334 WP_003097816.1.5235 WP_003097816.1.52409 WP_003097816.1.52449 WP_003097816.1.52500 WP_003097816.1.52537 WP_003097816.1.5258 WP_003097816.1.52583 WP_003097816.1.5260 WP_003097816.1.52690 WP_003097816.1.52700 WP_003097816.1.52728 WP_003097816.1.52784 WP_003097816.1.52790 WP_003097816.1.52850 WP_003097816.1.5294 WP_003097816.1.53037 WP_003097816.1.53038 WP_003097816.1.53070 WP_003097816.1.53072 WP_003097816.1.53169 WP_003097816.1.53267 WP_003097816.1.53351 WP_003097816.1.53371 WP_003097816.1.53414 WP_003097816.1.53427 WP_003097816.1.53486 WP_003097816.1.53528 WP_003097816.1.53530 WP_003097816.1.53663 WP_003097816.1.53719 WP_003097816.1.53726 WP_003097816.1.53932 WP_003097816.1.53948 WP_003097816.1.53951 WP_003097816.1.54090 WP_003097816.1.54133 WP_003097816.1.54140 WP_003097816.1.54146 WP_003097816.1.5420 WP_003097816.1.54248 WP_003097816.1.5427 WP_003097816.1.54462 WP_003097816.1.54497 WP_003097816.1.54742 WP_003097816.1.54809 WP_003097816.1.54974 WP_003097816.1.55089 WP_003097816.1.55169 WP_003097816.1.55347 WP_003097816.1.55387 WP_003097816.1.55400 WP_003097816.1.55445 WP_003097816.1.55729 WP_003097816.1.55813 WP_003097816.1.56013 WP_003097816.1.56037 WP_003097816.1.56145 WP_003097816.1.56187 WP_003097816.1.56228 WP_003097816.1.56229 WP_003097816.1.56315 WP_003097816.1.56348 WP_003097816.1.56442 WP_003097816.1.56452 WP_003097816.1.56474 WP_003097816.1.56475 WP_003097816.1.56623 WP_003097816.1.56626 WP_003097816.1.56632 WP_003097816.1.56745 WP_003097816.1.56768 WP_003097816.1.56797 WP_003097816.1.56819 WP_003097816.1.56837 WP_003097816.1.56973 WP_003097816.1.57005 WP_003097816.1.57020 WP_003097816.1.57113 WP_003097816.1.57131 WP_003097816.1.57276 WP_003097816.1.57339 WP_003097816.1.57369 WP_003097816.1.57417 WP_003097816.1.57480 WP_003097816.1.57532 WP_003097816.1.57548 WP_003097816.1.57566 WP_003097816.1.57728 WP_003097816.1.57853 WP_003097816.1.58056 WP_003097816.1.58183 WP_003097816.1.58193 WP_003097816.1.58200 WP_003097816.1.58228 WP_003097816.1.58360 WP_003097816.1.58436 WP_003097816.1.58482 WP_003097816.1.58510 WP_003097816.1.5856 WP_003097816.1.58689 WP_003097816.1.5869 WP_003097816.1.58800 WP_003097816.1.58838 WP_003097816.1.58845 WP_003097816.1.5889 WP_003097816.1.58944 WP_003097816.1.59013 WP_003097816.1.59076 WP_003097816.1.59099 WP_003097816.1.59123 WP_003097816.1.59176 WP_003097816.1.59246 WP_003097816.1.59249 WP_003097816.1.59376 WP_003097816.1.59563 WP_003097816.1.59759 WP_003097816.1.59797 WP_003097816.1.59831 WP_003097816.1.59870 WP_003097816.1.60051 WP_003097816.1.60062 WP_003097816.1.60079 WP_003097816.1.60084 WP_003097816.1.60085 WP_003097816.1.60206 WP_003097816.1.60261 WP_003097816.1.60347 WP_003097816.1.60364 WP_003097816.1.60415 WP_003097816.1.60467 WP_003097816.1.60472 WP_003097816.1.60509 WP_003097816.1.60600 WP_003097816.1.60602 WP_003097816.1.60603 WP_003097816.1.60639 WP_003097816.1.60686 WP_003097816.1.607 WP_003097816.1.60910 WP_003097816.1.60916 WP_003097816.1.60979 WP_003097816.1.61122 WP_003097816.1.61130 WP_003097816.1.61209 WP_003097816.1.61269 WP_003097816.1.6130 WP_003097816.1.61431 WP_003097816.1.61493 WP_003097816.1.61549 WP_003097816.1.61598 WP_003097816.1.61696 WP_003097816.1.6173 WP_003097816.1.61943 WP_003097816.1.62010 WP_003097816.1.62035 WP_003097816.1.62180 WP_003097816.1.62186 WP_003097816.1.62211 WP_003097816.1.62263 WP_003097816.1.62357 WP_003097816.1.62410 WP_003097816.1.6242 WP_003097816.1.62483 WP_003097816.1.62516 WP_003097816.1.62534 WP_003097816.1.62635 WP_003097816.1.62688 WP_003097816.1.62701 WP_003097816.1.62703 WP_003097816.1.62704 WP_003097816.1.62708 WP_003097816.1.62768 WP_003097816.1.62772 WP_003097816.1.6280 WP_003097816.1.6283 WP_003097816.1.62873 WP_003097816.1.62977 WP_003097816.1.63038 WP_003097816.1.63041 WP_003097816.1.63057 WP_003097816.1.63124 WP_003097816.1.63193 WP_003097816.1.63196 WP_003097816.1.63338 WP_003097816.1.63597 WP_003097816.1.63634 WP_003097816.1.63659 WP_003097816.1.63739 WP_003097816.1.64139 WP_003097816.1.64198 WP_003097816.1.64212 WP_003097816.1.64309 WP_003097816.1.64329 WP_003097816.1.64433 WP_003097816.1.6450 WP_003097816.1.64544 WP_003097816.1.64591 WP_003097816.1.64603 WP_003097816.1.6461 WP_003097816.1.64726 WP_003097816.1.64748 WP_003097816.1.64799 WP_003097816.1.64807 WP_003097816.1.64854 WP_003097816.1.64862 WP_003097816.1.64880 WP_003097816.1.64885 WP_003097816.1.64886 WP_003097816.1.64984 WP_003097816.1.65009 WP_003097816.1.65099 WP_003097816.1.65145 WP_003097816.1.65196 WP_003097816.1.65227 WP_003097816.1.65247 WP_003097816.1.65285 WP_003097816.1.65312 WP_003097816.1.65334 WP_003097816.1.65335 WP_003097816.1.65457 WP_003097816.1.65549 WP_003097816.1.65632 WP_003097816.1.65642 WP_003097816.1.65679 WP_003097816.1.65740 WP_003097816.1.65779 WP_003097816.1.65819 WP_003097816.1.65867 WP_003097816.1.6589 WP_003097816.1.65926 WP_003097816.1.66155 WP_003097816.1.66165 WP_003097816.1.66277 WP_003097816.1.6629 WP_003097816.1.66348 WP_003097816.1.66364 WP_003097816.1.66410 WP_003097816.1.66526 WP_003097816.1.66563 WP_003097816.1.66634 WP_003097816.1.66721 WP_003097816.1.66892 WP_003097816.1.66929 WP_003097816.1.66931 WP_003097816.1.66945 WP_003097816.1.66950 WP_003097816.1.67188 WP_003097816.1.67192 WP_003097816.1.67205 WP_003097816.1.67261 WP_003097816.1.67269 WP_003097816.1.67370 WP_003097816.1.67388 WP_003097816.1.67472 WP_003097816.1.67489 WP_003097816.1.67526 WP_003097816.1.67686 WP_003097816.1.67755 WP_003097816.1.67830 WP_003097816.1.67875 WP_003097816.1.67903 WP_003097816.1.67948 WP_003097816.1.68000 WP_003097816.1.68158 WP_003097816.1.68172 WP_003097816.1.68183 WP_003097816.1.68252 WP_003097816.1.68317 WP_003097816.1.68499 WP_003097816.1.6850 WP_003097816.1.68568 WP_003097816.1.68638 WP_003097816.1.6866 WP_003097816.1.68756 WP_003097816.1.68781 WP_003097816.1.68790 WP_003097816.1.68800 WP_003097816.1.68802 WP_003097816.1.68850 WP_003097816.1.68857 WP_003097816.1.68862 WP_003097816.1.68881 WP_003097816.1.68938 WP_003097816.1.68979 WP_003097816.1.69088 WP_003097816.1.6911 WP_003097816.1.69159 WP_003097816.1.69209 WP_003097816.1.69260 WP_003097816.1.69330 WP_003097816.1.6937 WP_003097816.1.69411 WP_003097816.1.69534 WP_003097816.1.69556 WP_003097816.1.69599 WP_003097816.1.69702 WP_003097816.1.69788 WP_003097816.1.69819 WP_003097816.1.69834 WP_003097816.1.69907 WP_003097816.1.69993 WP_003097816.1.70092 WP_003097816.1.70098 WP_003097816.1.70194 WP_003097816.1.70229 WP_003097816.1.70460 WP_003097816.1.70470 WP_003097816.1.70537 WP_003097816.1.70561 WP_003097816.1.70583 WP_003097816.1.70648 WP_003097816.1.70670 WP_003097816.1.70693 WP_003097816.1.7077 WP_003097816.1.70778 WP_003097816.1.70991 WP_003097816.1.71038 WP_003097816.1.71234 WP_003097816.1.71249 WP_003097816.1.71254 WP_003097816.1.7128 WP_003097816.1.71385 WP_003097816.1.71412 WP_003097816.1.7163 WP_003097816.1.71642 WP_003097816.1.71666 WP_003097816.1.71806 WP_003097816.1.71822 WP_003097816.1.71866 WP_003097816.1.71891 WP_003097816.1.71927 WP_003097816.1.71934 WP_003097816.1.72167 WP_003097816.1.72181 WP_003097816.1.72183 WP_003097816.1.72287 WP_003097816.1.72323 WP_003097816.1.72331 WP_003097816.1.72346 WP_003097816.1.72458 WP_003097816.1.72477 WP_003097816.1.72541 WP_003097816.1.72570 WP_003097816.1.72653 WP_003097816.1.72727 WP_003097816.1.7276 WP_003097816.1.72768 WP_003097816.1.72772 WP_003097816.1.72845 WP_003097816.1.72920 WP_003097816.1.73048 WP_003097816.1.7308 WP_003097816.1.73135 WP_003097816.1.73149 WP_003097816.1.73172 WP_003097816.1.73192 WP_003097816.1.7327 WP_003097816.1.733 WP_003097816.1.73455 WP_003097816.1.73490 WP_003097816.1.73523 WP_003097816.1.73601 WP_003097816.1.73651 WP_003097816.1.73719 WP_003097816.1.73728 WP_003097816.1.73791 WP_003097816.1.7382 WP_003097816.1.73860 WP_003097816.1.73911 WP_003097816.1.73941 WP_003097816.1.74 WP_003097816.1.74000 WP_003097816.1.74072 WP_003097816.1.74074 WP_003097816.1.7408 WP_003097816.1.74106 WP_003097816.1.74167 WP_003097816.1.74175 WP_003097816.1.74182 WP_003097816.1.74219 WP_003097816.1.74264 WP_003097816.1.74281 WP_003097816.1.74326 WP_003097816.1.7445 WP_003097816.1.74458 WP_003097816.1.74473 WP_003097816.1.74518 WP_003097816.1.7456 WP_003097816.1.74568 WP_003097816.1.74629 WP_003097816.1.74637 WP_003097816.1.74685 WP_003097816.1.74776 WP_003097816.1.748 WP_003097816.1.74941 WP_003097816.1.74948 WP_003097816.1.74958 WP_003097816.1.75041 WP_003097816.1.75119 WP_003097816.1.75204 WP_003097816.1.75277 WP_003097816.1.75303 WP_003097816.1.75431 WP_003097816.1.7547 WP_003097816.1.75549 WP_003097816.1.75573 WP_003097816.1.75599 WP_003097816.1.75603 WP_003097816.1.75631 WP_003097816.1.75771 WP_003097816.1.75792 WP_003097816.1.75825 WP_003097816.1.75826 WP_003097816.1.75935 WP_003097816.1.75938 WP_003097816.1.75947 WP_003097816.1.7595 WP_003097816.1.76077 WP_003097816.1.76092 WP_003097816.1.76141 WP_003097816.1.76192 WP_003097816.1.76322 WP_003097816.1.76355 WP_003097816.1.76383 WP_003097816.1.76467 WP_003097816.1.76484 WP_003097816.1.76543 WP_003097816.1.76600 WP_003097816.1.76633 WP_003097816.1.76716 WP_003097816.1.76775 WP_003097816.1.76861 WP_003097816.1.76985 WP_003097816.1.77235 WP_003097816.1.77317 WP_003097816.1.77490 WP_003097816.1.77566 WP_003097816.1.77574 WP_003097816.1.77587 WP_003097816.1.77686 WP_003097816.1.77750 WP_003097816.1.77769 WP_003097816.1.7779 WP_003097816.1.77819 WP_003097816.1.78104 WP_003097816.1.78112 WP_003097816.1.78118 WP_003097816.1.78134 WP_003097816.1.78148 WP_003097816.1.78280 WP_003097816.1.78288 WP_003097816.1.78380 WP_003097816.1.7840 WP_003097816.1.78430 WP_003097816.1.78437 WP_003097816.1.78570 WP_003097816.1.78623 WP_003097816.1.78693 WP_003097816.1.78795 WP_003097816.1.78810 WP_003097816.1.78947 WP_003097816.1.78954 WP_003097816.1.79053 WP_003097816.1.79177 WP_003097816.1.79256 WP_003097816.1.79279 WP_003097816.1.79286 WP_003097816.1.79311 WP_003097816.1.79364 WP_003097816.1.79421 WP_003097816.1.79429 WP_003097816.1.79431 WP_003097816.1.79463 WP_003097816.1.7953 WP_003097816.1.79544 WP_003097816.1.79569 WP_003097816.1.79601 WP_003097816.1.79631 WP_003097816.1.79754 WP_003097816.1.79788 WP_003097816.1.79862 WP_003097816.1.79883 WP_003097816.1.79902 WP_003097816.1.79908 WP_003097816.1.79986 WP_003097816.1.8 WP_003097816.1.80033 WP_003097816.1.80087 WP_003097816.1.8013 WP_003097816.1.80174 WP_003097816.1.80258 WP_003097816.1.8028 WP_003097816.1.80306 WP_003097816.1.8038 WP_003097816.1.80410 WP_003097816.1.80411 WP_003097816.1.80454 WP_003097816.1.80481 WP_003097816.1.8051 WP_003097816.1.80535 WP_003097816.1.80627 WP_003097816.1.80632 WP_003097816.1.8064 WP_003097816.1.80645 WP_003097816.1.80683 WP_003097816.1.80720 WP_003097816.1.80785 WP_003097816.1.80846 WP_003097816.1.80880 WP_003097816.1.80892 WP_003097816.1.80910 WP_003097816.1.80931 WP_003097816.1.80938 WP_003097816.1.80969 WP_003097816.1.81081 WP_003097816.1.81082 WP_003097816.1.8110 WP_003097816.1.81206 WP_003097816.1.81331 WP_003097816.1.81380 WP_003097816.1.81426 WP_003097816.1.81470 WP_003097816.1.81482 WP_003097816.1.81487 WP_003097816.1.81581 WP_003097816.1.81591 WP_003097816.1.81622 WP_003097816.1.81643 WP_003097816.1.81708 WP_003097816.1.81728 WP_003097816.1.81742 WP_003097816.1.81771 WP_003097816.1.81802 WP_003097816.1.81834 WP_003097816.1.81844 WP_003097816.1.81856 WP_003097816.1.81874 WP_003097816.1.81927 WP_003097816.1.81950 WP_003097816.1.81957 WP_003097816.1.81960 WP_003097816.1.81986 WP_003097816.1.82117 WP_003097816.1.82127 WP_003097816.1.82310 WP_003097816.1.82312 WP_003097816.1.82328 WP_003097816.1.82334 WP_003097816.1.82604 WP_003097816.1.82606 WP_003097816.1.82620 WP_003097816.1.82643 WP_003097816.1.82686 WP_003097816.1.82710 WP_003097816.1.8284 WP_003097816.1.82864 WP_003097816.1.82882 WP_003097816.1.83131 WP_003097816.1.83184 WP_003097816.1.83213 WP_003097816.1.83251 WP_003097816.1.83267 WP_003097816.1.83296 WP_003097816.1.83317 WP_003097816.1.83374 WP_003097816.1.83394 WP_003097816.1.83440 WP_003097816.1.83460 WP_003097816.1.835 WP_003097816.1.83503 WP_003097816.1.8353 WP_003097816.1.83540 WP_003097816.1.8357 WP_003097816.1.83698 WP_003097816.1.83715 WP_003097816.1.83946 WP_003097816.1.84003 WP_003097816.1.84008 WP_003097816.1.84138 WP_003097816.1.84174 WP_003097816.1.84178 WP_003097816.1.84190 WP_003097816.1.84203 WP_003097816.1.84271 WP_003097816.1.84297 WP_003097816.1.8437 WP_003097816.1.84374 WP_003097816.1.84398 WP_003097816.1.84404 WP_003097816.1.84439 WP_003097816.1.84471 WP_003097816.1.84487 WP_003097816.1.84526 WP_003097816.1.8453 WP_003097816.1.84538 WP_003097816.1.84558 WP_003097816.1.84589 WP_003097816.1.84674 WP_003097816.1.84702 WP_003097816.1.84715 WP_003097816.1.84754 WP_003097816.1.84792 WP_003097816.1.8484 WP_003097816.1.84865 WP_003097816.1.84937 WP_003097816.1.84946 WP_003097816.1.8498 WP_003097816.1.85018 WP_003097816.1.85150 WP_003097816.1.85290 WP_003097816.1.85303 WP_003097816.1.85311 WP_003097816.1.85318 WP_003097816.1.85574 WP_003097816.1.85638 WP_003097816.1.85788 WP_003097816.1.85897 WP_003097816.1.85910 WP_003097816.1.85920 WP_003097816.1.86002 WP_003097816.1.86047 WP_003097816.1.86058 WP_003097816.1.861 WP_003097816.1.86278 WP_003097816.1.86287 WP_003097816.1.86293 WP_003097816.1.86386 WP_003097816.1.865 WP_003097816.1.86545 WP_003097816.1.86552 WP_003097816.1.86554 WP_003097816.1.86652 WP_003097816.1.86665 WP_003097816.1.86708 WP_003097816.1.86733 WP_003097816.1.86785 WP_003097816.1.86796 WP_003097816.1.86813 WP_003097816.1.86822 WP_003097816.1.8693 WP_003097816.1.86947 WP_003097816.1.86970 WP_003097816.1.86985 WP_003097816.1.87104 WP_003097816.1.87163 WP_003097816.1.8718 WP_003097816.1.87182 WP_003097816.1.8727 WP_003097816.1.87316 WP_003097816.1.87390 WP_003097816.1.87435 WP_003097816.1.87463 WP_003097816.1.87530 WP_003097816.1.87547 WP_003097816.1.87648 WP_003097816.1.87763 WP_003097816.1.8777 WP_003097816.1.8785 WP_003097816.1.87877 WP_003097816.1.87888 WP_003097816.1.87970 WP_003097816.1.87981 WP_003097816.1.87987 WP_003097816.1.88004 WP_003097816.1.88308 WP_003097816.1.88330 WP_003097816.1.88388 WP_003097816.1.88415 WP_003097816.1.88517 WP_003097816.1.88540 WP_003097816.1.88578 WP_003097816.1.88605 WP_003097816.1.88659 WP_003097816.1.88679 WP_003097816.1.88680 WP_003097816.1.88714 WP_003097816.1.88900 WP_003097816.1.88949 WP_003097816.1.89098 WP_003097816.1.8911 WP_003097816.1.89234 WP_003097816.1.89245 WP_003097816.1.89266 WP_003097816.1.89276 WP_003097816.1.89409 WP_003097816.1.89434 WP_003097816.1.89440 WP_003097816.1.89480 WP_003097816.1.8949 WP_003097816.1.89523 WP_003097816.1.89577 WP_003097816.1.89610 WP_003097816.1.89638 WP_003097816.1.89662 WP_003097816.1.89736 WP_003097816.1.89776 WP_003097816.1.89805 WP_003097816.1.89866 WP_003097816.1.89867 WP_003097816.1.89868 WP_003097816.1.89886 WP_003097816.1.89992 WP_003097816.1.90024 WP_003097816.1.90032 WP_003097816.1.90056 WP_003097816.1.90141 WP_003097816.1.90189 WP_003097816.1.90224 WP_003097816.1.90242 WP_003097816.1.90306 WP_003097816.1.90412 WP_003097816.1.9056 WP_003097816.1.90569 WP_003097816.1.90655 WP_003097816.1.90770 WP_003097816.1.90940 WP_003097816.1.91093 WP_003097816.1.91161 WP_003097816.1.9120 WP_003097816.1.91204 WP_003097816.1.91360 WP_003097816.1.91392 WP_003097816.1.9143 WP_003097816.1.91431 WP_003097816.1.91438 WP_003097816.1.91467 WP_003097816.1.91563 WP_003097816.1.91585 WP_003097816.1.91796 WP_003097816.1.91803 WP_003097816.1.9182 WP_003097816.1.91846 WP_003097816.1.91860 WP_003097816.1.91862 WP_003097816.1.9191 WP_003097816.1.91938 WP_003097816.1.91996 WP_003097816.1.92175 WP_003097816.1.9219 WP_003097816.1.92314 WP_003097816.1.92321 WP_003097816.1.92357 WP_003097816.1.92454 WP_003097816.1.92573 WP_003097816.1.92585 WP_003097816.1.92587 WP_003097816.1.92589 WP_003097816.1.92594 WP_003097816.1.92624 WP_003097816.1.92630 WP_003097816.1.9272 WP_003097816.1.92759 WP_003097816.1.92769 WP_003097816.1.92894 WP_003097816.1.92924 WP_003097816.1.92930 WP_003097816.1.93001 WP_003097816.1.93090 WP_003097816.1.93144 WP_003097816.1.93148 WP_003097816.1.93250 WP_003097816.1.93264 WP_003097816.1.9328 WP_003097816.1.93446 WP_003097816.1.93493 WP_003097816.1.93568 WP_003097816.1.93797 WP_003097816.1.93848 WP_003097816.1.93889 WP_003097816.1.93897 WP_003097816.1.94004 WP_003097816.1.94078 WP_003097816.1.94174 WP_003097816.1.94218 WP_003097816.1.94221 WP_003097816.1.94243 WP_003097816.1.94285 WP_003097816.1.94333 WP_003097816.1.94385 WP_003097816.1.94434 WP_003097816.1.9444 WP_003097816.1.94450 WP_003097816.1.94682 WP_003097816.1.94732 WP_003097816.1.94742 WP_003097816.1.94814 WP_003097816.1.94818 WP_003097816.1.94856 WP_003097816.1.94896 WP_003097816.1.94897 WP_003097816.1.95025 WP_003097816.1.95027 WP_003097816.1.95056 WP_003097816.1.95117 WP_003097816.1.95132 WP_003097816.1.95187 WP_003097816.1.95207 WP_003097816.1.95217 WP_003097816.1.95305 WP_003097816.1.95324 WP_003097816.1.95488 WP_003097816.1.95525 WP_003097816.1.95536 WP_003097816.1.95668 WP_003097816.1.95745 WP_003097816.1.95751 WP_003097816.1.95774 WP_003097816.1.95782 WP_003097816.1.95787 WP_003097816.1.95802 WP_003097816.1.95820 WP_003097816.1.95825 WP_003097816.1.9599 WP_003097816.1.95994 WP_003097816.1.95999 WP_003097816.1.96008 WP_003097816.1.9604 WP_003097816.1.96041 WP_003097816.1.96058 WP_003097816.1.961 WP_003097816.1.96134 WP_003097816.1.96193 WP_003097816.1.96243 WP_003097816.1.96267 WP_003097816.1.96357 WP_003097816.1.96434 WP_003097816.1.96506 WP_003097816.1.96667 WP_003097816.1.96702 WP_003097816.1.96880 WP_003097816.1.96967 WP_003097816.1.9706 WP_003097816.1.97118 WP_003097816.1.97126 WP_003097816.1.97213 WP_003097816.1.9722 WP_003097816.1.97271 WP_003097816.1.97272 WP_003097816.1.97377 WP_003097816.1.97461 WP_003097816.1.97474 WP_003097816.1.97488 WP_003097816.1.97499 WP_003097816.1.97583 WP_003097816.1.97614 WP_003097816.1.97826 WP_003097816.1.97877 WP_003097816.1.97968 WP_003097816.1.98260 WP_003097816.1.98276 WP_003097816.1.98308 WP_003097816.1.98410 WP_003097816.1.98414 WP_003097816.1.98433 WP_003097816.1.985 WP_003097816.1.98522 WP_003097816.1.98573 WP_003097816.1.98600 WP_003097816.1.98610 WP_003097816.1.98672 WP_003097816.1.98678 WP_003097816.1.98693 WP_003097816.1.98788 WP_003097816.1.98814 WP_003097816.1.9885 WP_003097816.1.98873 WP_003097816.1.98926 WP_003097816.1.98958 WP_003097816.1.98960 WP_003097816.1.98963 WP_003097816.1.99065 WP_003097816.1.99068 WP_003097816.1.99103 WP_003097816.1.99214 WP_003097816.1.99293 WP_003097816.1.99378 WP_003097816.1.99386 WP_003097816.1.99461 WP_003097816.1.9951 WP_003097816.1.99647 WP_003097816.1.99654 WP_003097816.1.99662 WP_003097816.1.99746 WP_003097816.1.99757 WP_003097816.1.99772 WP_003097816.1.99795 WP_003097816.1.9989 gi|514409104|ref|YP_008132206.1| gi|116049600|ref|YP_791595.1| gi|568154821|ref|YP_008943805.1| APC37554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]