SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154853|ref|YP_008943837.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154853|ref|YP_008943837.1|
Domain Number 1 Region: 74-197
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.94e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.94e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568154853|ref|YP_008943837.1|
Sequence length 220
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDN
DDFAVFESGAILIYLAEKTGQLMPADVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPE
KLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDN
LQRWIAAIEARPAVQRGLLVPRREKEGDDAIRTAQSMLTR
Download sequence
Identical sequences A0A071KV27 A0A0E1AVH2 A0A0H2Z874 A0A157W335 A0A1E9BTK0 A0A1G5GDI3 A0A1S1BX55 V6AHA5 W1MNV5
gi|218892420|ref|YP_002441287.1| gi|392984913|ref|YP_006483500.1| gi|116049568|ref|YP_791628.1| gi|478479608|ref|YP_007710259.1| 208963.PA14_43530 557722.PLES_37041 gi|568154853|ref|YP_008943837.1| gi|564953403|ref|YP_008885973.1| WP_003087500.1.100071 WP_003087500.1.100278 WP_003087500.1.100420 WP_003087500.1.100469 WP_003087500.1.100473 WP_003087500.1.100476 WP_003087500.1.100523 WP_003087500.1.100808 WP_003087500.1.100810 WP_003087500.1.100983 WP_003087500.1.100995 WP_003087500.1.101047 WP_003087500.1.101090 WP_003087500.1.101269 WP_003087500.1.101310 WP_003087500.1.101590 WP_003087500.1.101712 WP_003087500.1.10174 WP_003087500.1.101781 WP_003087500.1.101809 WP_003087500.1.10201 WP_003087500.1.10202 WP_003087500.1.10204 WP_003087500.1.102045 WP_003087500.1.10228 WP_003087500.1.10248 WP_003087500.1.10271 WP_003087500.1.1037 WP_003087500.1.10419 WP_003087500.1.10435 WP_003087500.1.10457 WP_003087500.1.10513 WP_003087500.1.10548 WP_003087500.1.10572 WP_003087500.1.10575 WP_003087500.1.10636 WP_003087500.1.10641 WP_003087500.1.10764 WP_003087500.1.10895 WP_003087500.1.11026 WP_003087500.1.11077 WP_003087500.1.1109 WP_003087500.1.11130 WP_003087500.1.11163 WP_003087500.1.11178 WP_003087500.1.11318 WP_003087500.1.11569 WP_003087500.1.11653 WP_003087500.1.11744 WP_003087500.1.1180 WP_003087500.1.1183 WP_003087500.1.11847 WP_003087500.1.11854 WP_003087500.1.11943 WP_003087500.1.12018 WP_003087500.1.12081 WP_003087500.1.12120 WP_003087500.1.12150 WP_003087500.1.12200 WP_003087500.1.1238 WP_003087500.1.12400 WP_003087500.1.12482 WP_003087500.1.12497 WP_003087500.1.12547 WP_003087500.1.12660 WP_003087500.1.12744 WP_003087500.1.12797 WP_003087500.1.12873 WP_003087500.1.12890 WP_003087500.1.12891 WP_003087500.1.12930 WP_003087500.1.12970 WP_003087500.1.13 WP_003087500.1.13041 WP_003087500.1.1305 WP_003087500.1.13057 WP_003087500.1.13077 WP_003087500.1.13085 WP_003087500.1.13092 WP_003087500.1.13232 WP_003087500.1.13266 WP_003087500.1.1333 WP_003087500.1.13364 WP_003087500.1.1356 WP_003087500.1.1362 WP_003087500.1.13622 WP_003087500.1.13642 WP_003087500.1.13718 WP_003087500.1.13743 WP_003087500.1.13765 WP_003087500.1.14116 WP_003087500.1.14251 WP_003087500.1.14378 WP_003087500.1.14476 WP_003087500.1.14525 WP_003087500.1.14615 WP_003087500.1.14679 WP_003087500.1.14690 WP_003087500.1.14714 WP_003087500.1.1475 WP_003087500.1.14815 WP_003087500.1.14820 WP_003087500.1.14839 WP_003087500.1.14883 WP_003087500.1.14981 WP_003087500.1.15004 WP_003087500.1.1516 WP_003087500.1.15222 WP_003087500.1.15231 WP_003087500.1.15281 WP_003087500.1.15328 WP_003087500.1.15373 WP_003087500.1.15408 WP_003087500.1.15474 WP_003087500.1.15480 WP_003087500.1.15485 WP_003087500.1.15602 WP_003087500.1.15666 WP_003087500.1.15886 WP_003087500.1.15889 WP_003087500.1.15934 WP_003087500.1.16109 WP_003087500.1.16161 WP_003087500.1.16197 WP_003087500.1.162 WP_003087500.1.16419 WP_003087500.1.1671 WP_003087500.1.16751 WP_003087500.1.16788 WP_003087500.1.16801 WP_003087500.1.16808 WP_003087500.1.16811 WP_003087500.1.1704 WP_003087500.1.17108 WP_003087500.1.17155 WP_003087500.1.17162 WP_003087500.1.17177 WP_003087500.1.17189 WP_003087500.1.17223 WP_003087500.1.17353 WP_003087500.1.17354 WP_003087500.1.1739 WP_003087500.1.17499 WP_003087500.1.17566 WP_003087500.1.1758 WP_003087500.1.17697 WP_003087500.1.17883 WP_003087500.1.17890 WP_003087500.1.18054 WP_003087500.1.18117 WP_003087500.1.18156 WP_003087500.1.18157 WP_003087500.1.18199 WP_003087500.1.1824 WP_003087500.1.18349 WP_003087500.1.18440 WP_003087500.1.18508 WP_003087500.1.18732 WP_003087500.1.18735 WP_003087500.1.18795 WP_003087500.1.18892 WP_003087500.1.18907 WP_003087500.1.190 WP_003087500.1.19089 WP_003087500.1.19199 WP_003087500.1.19269 WP_003087500.1.19346 WP_003087500.1.19351 WP_003087500.1.19376 WP_003087500.1.19591 WP_003087500.1.19640 WP_003087500.1.19703 WP_003087500.1.1971 WP_003087500.1.19711 WP_003087500.1.19718 WP_003087500.1.19771 WP_003087500.1.19803 WP_003087500.1.19824 WP_003087500.1.19930 WP_003087500.1.19931 WP_003087500.1.2012 WP_003087500.1.20125 WP_003087500.1.20134 WP_003087500.1.20590 WP_003087500.1.20682 WP_003087500.1.20692 WP_003087500.1.20744 WP_003087500.1.20764 WP_003087500.1.20825 WP_003087500.1.20880 WP_003087500.1.20884 WP_003087500.1.20890 WP_003087500.1.209 WP_003087500.1.20978 WP_003087500.1.21002 WP_003087500.1.21039 WP_003087500.1.21096 WP_003087500.1.21209 WP_003087500.1.21242 WP_003087500.1.21253 WP_003087500.1.21349 WP_003087500.1.21448 WP_003087500.1.21469 WP_003087500.1.21517 WP_003087500.1.21607 WP_003087500.1.21718 WP_003087500.1.2172 WP_003087500.1.21744 WP_003087500.1.21767 WP_003087500.1.21801 WP_003087500.1.21863 WP_003087500.1.21871 WP_003087500.1.21891 WP_003087500.1.21932 WP_003087500.1.221 WP_003087500.1.22365 WP_003087500.1.2237 WP_003087500.1.22389 WP_003087500.1.22390 WP_003087500.1.22477 WP_003087500.1.22573 WP_003087500.1.22704 WP_003087500.1.22863 WP_003087500.1.2289 WP_003087500.1.22891 WP_003087500.1.23013 WP_003087500.1.23166 WP_003087500.1.23191 WP_003087500.1.23195 WP_003087500.1.2323 WP_003087500.1.23264 WP_003087500.1.23394 WP_003087500.1.23418 WP_003087500.1.23421 WP_003087500.1.23512 WP_003087500.1.2355 WP_003087500.1.23581 WP_003087500.1.23611 WP_003087500.1.23641 WP_003087500.1.23715 WP_003087500.1.2374 WP_003087500.1.23794 WP_003087500.1.23884 WP_003087500.1.23925 WP_003087500.1.23938 WP_003087500.1.23961 WP_003087500.1.24066 WP_003087500.1.24077 WP_003087500.1.24087 WP_003087500.1.24101 WP_003087500.1.24183 WP_003087500.1.24234 WP_003087500.1.24319 WP_003087500.1.24351 WP_003087500.1.24382 WP_003087500.1.24413 WP_003087500.1.2453 WP_003087500.1.24626 WP_003087500.1.24662 WP_003087500.1.24851 WP_003087500.1.24862 WP_003087500.1.24869 WP_003087500.1.24938 WP_003087500.1.24940 WP_003087500.1.251 WP_003087500.1.25109 WP_003087500.1.25142 WP_003087500.1.25149 WP_003087500.1.2530 WP_003087500.1.25348 WP_003087500.1.2535 WP_003087500.1.25532 WP_003087500.1.25641 WP_003087500.1.25695 WP_003087500.1.25834 WP_003087500.1.2596 WP_003087500.1.25964 WP_003087500.1.26010 WP_003087500.1.26042 WP_003087500.1.261 WP_003087500.1.26159 WP_003087500.1.26473 WP_003087500.1.2652 WP_003087500.1.26539 WP_003087500.1.26553 WP_003087500.1.26592 WP_003087500.1.26682 WP_003087500.1.26740 WP_003087500.1.26816 WP_003087500.1.26862 WP_003087500.1.26967 WP_003087500.1.2698 WP_003087500.1.27018 WP_003087500.1.27073 WP_003087500.1.27211 WP_003087500.1.27218 WP_003087500.1.27259 WP_003087500.1.27288 WP_003087500.1.27505 WP_003087500.1.27534 WP_003087500.1.27549 WP_003087500.1.27575 WP_003087500.1.27587 WP_003087500.1.27738 WP_003087500.1.27783 WP_003087500.1.27837 WP_003087500.1.27858 WP_003087500.1.27933 WP_003087500.1.27966 WP_003087500.1.28006 WP_003087500.1.28064 WP_003087500.1.28078 WP_003087500.1.28136 WP_003087500.1.28175 WP_003087500.1.28193 WP_003087500.1.28316 WP_003087500.1.28382 WP_003087500.1.28404 WP_003087500.1.28468 WP_003087500.1.28560 WP_003087500.1.28699 WP_003087500.1.28713 WP_003087500.1.28757 WP_003087500.1.28849 WP_003087500.1.28878 WP_003087500.1.28920 WP_003087500.1.29003 WP_003087500.1.29008 WP_003087500.1.29062 WP_003087500.1.29070 WP_003087500.1.29096 WP_003087500.1.29127 WP_003087500.1.29137 WP_003087500.1.29208 WP_003087500.1.2927 WP_003087500.1.29401 WP_003087500.1.2941 WP_003087500.1.29440 WP_003087500.1.29481 WP_003087500.1.29498 WP_003087500.1.29501 WP_003087500.1.29577 WP_003087500.1.29633 WP_003087500.1.29650 WP_003087500.1.29767 WP_003087500.1.29920 WP_003087500.1.29958 WP_003087500.1.29973 WP_003087500.1.30020 WP_003087500.1.30081 WP_003087500.1.30120 WP_003087500.1.30254 WP_003087500.1.3030 WP_003087500.1.30365 WP_003087500.1.30563 WP_003087500.1.30567 WP_003087500.1.30615 WP_003087500.1.30693 WP_003087500.1.30707 WP_003087500.1.30842 WP_003087500.1.30886 WP_003087500.1.30943 WP_003087500.1.30994 WP_003087500.1.31076 WP_003087500.1.31087 WP_003087500.1.31103 WP_003087500.1.31105 WP_003087500.1.31138 WP_003087500.1.31147 WP_003087500.1.31279 WP_003087500.1.31457 WP_003087500.1.31501 WP_003087500.1.31633 WP_003087500.1.31655 WP_003087500.1.3172 WP_003087500.1.31732 WP_003087500.1.31741 WP_003087500.1.31751 WP_003087500.1.31848 WP_003087500.1.319 WP_003087500.1.32134 WP_003087500.1.32137 WP_003087500.1.32235 WP_003087500.1.32289 WP_003087500.1.32314 WP_003087500.1.32359 WP_003087500.1.32447 WP_003087500.1.32544 WP_003087500.1.32596 WP_003087500.1.32626 WP_003087500.1.32637 WP_003087500.1.32711 WP_003087500.1.32821 WP_003087500.1.32998 WP_003087500.1.33009 WP_003087500.1.33047 WP_003087500.1.33133 WP_003087500.1.33152 WP_003087500.1.33210 WP_003087500.1.33216 WP_003087500.1.33294 WP_003087500.1.33340 WP_003087500.1.33387 WP_003087500.1.33438 WP_003087500.1.33441 WP_003087500.1.33547 WP_003087500.1.33549 WP_003087500.1.33653 WP_003087500.1.33658 WP_003087500.1.33669 WP_003087500.1.3368 WP_003087500.1.33728 WP_003087500.1.33733 WP_003087500.1.33734 WP_003087500.1.33814 WP_003087500.1.33822 WP_003087500.1.33824 WP_003087500.1.33833 WP_003087500.1.3385 WP_003087500.1.33945 WP_003087500.1.34000 WP_003087500.1.34150 WP_003087500.1.34180 WP_003087500.1.34203 WP_003087500.1.34306 WP_003087500.1.34317 WP_003087500.1.3436 WP_003087500.1.34402 WP_003087500.1.34461 WP_003087500.1.34465 WP_003087500.1.34556 WP_003087500.1.34583 WP_003087500.1.34670 WP_003087500.1.34832 WP_003087500.1.34837 WP_003087500.1.34878 WP_003087500.1.34901 WP_003087500.1.35036 WP_003087500.1.35104 WP_003087500.1.35149 WP_003087500.1.35231 WP_003087500.1.35281 WP_003087500.1.35442 WP_003087500.1.35529 WP_003087500.1.3555 WP_003087500.1.35573 WP_003087500.1.35599 WP_003087500.1.35641 WP_003087500.1.35669 WP_003087500.1.35679 WP_003087500.1.35682 WP_003087500.1.3576 WP_003087500.1.35762 WP_003087500.1.35768 WP_003087500.1.35822 WP_003087500.1.35843 WP_003087500.1.35857 WP_003087500.1.35872 WP_003087500.1.35968 WP_003087500.1.35984 WP_003087500.1.36064 WP_003087500.1.36121 WP_003087500.1.36148 WP_003087500.1.36170 WP_003087500.1.36267 WP_003087500.1.36285 WP_003087500.1.36521 WP_003087500.1.36587 WP_003087500.1.36608 WP_003087500.1.36708 WP_003087500.1.36756 WP_003087500.1.36879 WP_003087500.1.37050 WP_003087500.1.37097 WP_003087500.1.37125 WP_003087500.1.37163 WP_003087500.1.3721 WP_003087500.1.37216 WP_003087500.1.373 WP_003087500.1.37319 WP_003087500.1.37366 WP_003087500.1.37416 WP_003087500.1.3742 WP_003087500.1.37512 WP_003087500.1.37571 WP_003087500.1.3768 WP_003087500.1.37698 WP_003087500.1.37703 WP_003087500.1.3773 WP_003087500.1.37814 WP_003087500.1.37826 WP_003087500.1.37842 WP_003087500.1.38023 WP_003087500.1.38060 WP_003087500.1.38087 WP_003087500.1.38102 WP_003087500.1.38146 WP_003087500.1.38151 WP_003087500.1.3818 WP_003087500.1.3833 WP_003087500.1.38335 WP_003087500.1.38430 WP_003087500.1.38502 WP_003087500.1.38505 WP_003087500.1.38510 WP_003087500.1.38582 WP_003087500.1.38583 WP_003087500.1.38587 WP_003087500.1.38661 WP_003087500.1.38816 WP_003087500.1.38889 WP_003087500.1.38932 WP_003087500.1.38971 WP_003087500.1.39046 WP_003087500.1.39088 WP_003087500.1.39122 WP_003087500.1.39186 WP_003087500.1.39271 WP_003087500.1.39326 WP_003087500.1.39345 WP_003087500.1.3943 WP_003087500.1.39444 WP_003087500.1.39458 WP_003087500.1.39765 WP_003087500.1.39786 WP_003087500.1.39920 WP_003087500.1.39949 WP_003087500.1.40059 WP_003087500.1.40115 WP_003087500.1.40207 WP_003087500.1.40237 WP_003087500.1.40243 WP_003087500.1.40271 WP_003087500.1.40442 WP_003087500.1.40512 WP_003087500.1.40546 WP_003087500.1.4058 WP_003087500.1.40984 WP_003087500.1.40993 WP_003087500.1.41110 WP_003087500.1.41137 WP_003087500.1.41199 WP_003087500.1.41290 WP_003087500.1.41301 WP_003087500.1.41384 WP_003087500.1.41412 WP_003087500.1.41429 WP_003087500.1.41487 WP_003087500.1.41502 WP_003087500.1.41692 WP_003087500.1.41703 WP_003087500.1.41732 WP_003087500.1.41832 WP_003087500.1.41888 WP_003087500.1.4190 WP_003087500.1.4196 WP_003087500.1.42 WP_003087500.1.42047 WP_003087500.1.42146 WP_003087500.1.42259 WP_003087500.1.42294 WP_003087500.1.42316 WP_003087500.1.42381 WP_003087500.1.42388 WP_003087500.1.42411 WP_003087500.1.42423 WP_003087500.1.42463 WP_003087500.1.42499 WP_003087500.1.42508 WP_003087500.1.42634 WP_003087500.1.42643 WP_003087500.1.42690 WP_003087500.1.42723 WP_003087500.1.4273 WP_003087500.1.42754 WP_003087500.1.42757 WP_003087500.1.42789 WP_003087500.1.42854 WP_003087500.1.42870 WP_003087500.1.42946 WP_003087500.1.42973 WP_003087500.1.43022 WP_003087500.1.43024 WP_003087500.1.43026 WP_003087500.1.43049 WP_003087500.1.43107 WP_003087500.1.43212 WP_003087500.1.43245 WP_003087500.1.43286 WP_003087500.1.43293 WP_003087500.1.43326 WP_003087500.1.43330 WP_003087500.1.43356 WP_003087500.1.43603 WP_003087500.1.43662 WP_003087500.1.43667 WP_003087500.1.43696 WP_003087500.1.43729 WP_003087500.1.43756 WP_003087500.1.4381 WP_003087500.1.43826 WP_003087500.1.4397 WP_003087500.1.4398 WP_003087500.1.43998 WP_003087500.1.44213 WP_003087500.1.44260 WP_003087500.1.44269 WP_003087500.1.44486 WP_003087500.1.445 WP_003087500.1.44552 WP_003087500.1.44581 WP_003087500.1.44725 WP_003087500.1.44739 WP_003087500.1.44760 WP_003087500.1.44804 WP_003087500.1.44870 WP_003087500.1.4493 WP_003087500.1.44959 WP_003087500.1.45063 WP_003087500.1.45090 WP_003087500.1.45146 WP_003087500.1.45228 WP_003087500.1.45298 WP_003087500.1.45306 WP_003087500.1.4532 WP_003087500.1.45353 WP_003087500.1.45358 WP_003087500.1.45464 WP_003087500.1.45485 WP_003087500.1.45604 WP_003087500.1.45611 WP_003087500.1.45635 WP_003087500.1.45636 WP_003087500.1.45678 WP_003087500.1.45700 WP_003087500.1.45723 WP_003087500.1.45934 WP_003087500.1.45946 WP_003087500.1.46010 WP_003087500.1.461 WP_003087500.1.46152 WP_003087500.1.46200 WP_003087500.1.46306 WP_003087500.1.4640 WP_003087500.1.46623 WP_003087500.1.46633 WP_003087500.1.46755 WP_003087500.1.46885 WP_003087500.1.46926 WP_003087500.1.46935 WP_003087500.1.4699 WP_003087500.1.47101 WP_003087500.1.47155 WP_003087500.1.4726 WP_003087500.1.47296 WP_003087500.1.47312 WP_003087500.1.47314 WP_003087500.1.47374 WP_003087500.1.47469 WP_003087500.1.47551 WP_003087500.1.47645 WP_003087500.1.47774 WP_003087500.1.47930 WP_003087500.1.47970 WP_003087500.1.48001 WP_003087500.1.48024 WP_003087500.1.48086 WP_003087500.1.48094 WP_003087500.1.48178 WP_003087500.1.48378 WP_003087500.1.48382 WP_003087500.1.48472 WP_003087500.1.48474 WP_003087500.1.48487 WP_003087500.1.48546 WP_003087500.1.48576 WP_003087500.1.48579 WP_003087500.1.48810 WP_003087500.1.48820 WP_003087500.1.48840 WP_003087500.1.48842 WP_003087500.1.48851 WP_003087500.1.49108 WP_003087500.1.49244 WP_003087500.1.49265 WP_003087500.1.49266 WP_003087500.1.49293 WP_003087500.1.49500 WP_003087500.1.49557 WP_003087500.1.49688 WP_003087500.1.49798 WP_003087500.1.49806 WP_003087500.1.49833 WP_003087500.1.49842 WP_003087500.1.49922 WP_003087500.1.49948 WP_003087500.1.49976 WP_003087500.1.49988 WP_003087500.1.49998 WP_003087500.1.50176 WP_003087500.1.50222 WP_003087500.1.50232 WP_003087500.1.50242 WP_003087500.1.5043 WP_003087500.1.50450 WP_003087500.1.50459 WP_003087500.1.50567 WP_003087500.1.50691 WP_003087500.1.50783 WP_003087500.1.50814 WP_003087500.1.50922 WP_003087500.1.50967 WP_003087500.1.50989 WP_003087500.1.51019 WP_003087500.1.51035 WP_003087500.1.51183 WP_003087500.1.51267 WP_003087500.1.51273 WP_003087500.1.51457 WP_003087500.1.51472 WP_003087500.1.51501 WP_003087500.1.51549 WP_003087500.1.51682 WP_003087500.1.51727 WP_003087500.1.51807 WP_003087500.1.51847 WP_003087500.1.51928 WP_003087500.1.51957 WP_003087500.1.52043 WP_003087500.1.52212 WP_003087500.1.52220 WP_003087500.1.52244 WP_003087500.1.5226 WP_003087500.1.52334 WP_003087500.1.52372 WP_003087500.1.52403 WP_003087500.1.52409 WP_003087500.1.52500 WP_003087500.1.52537 WP_003087500.1.5258 WP_003087500.1.52583 WP_003087500.1.52591 WP_003087500.1.52690 WP_003087500.1.52697 WP_003087500.1.52700 WP_003087500.1.52784 WP_003087500.1.52790 WP_003087500.1.52850 WP_003087500.1.5289 WP_003087500.1.52939 WP_003087500.1.53038 WP_003087500.1.53070 WP_003087500.1.53072 WP_003087500.1.53351 WP_003087500.1.53371 WP_003087500.1.53414 WP_003087500.1.53528 WP_003087500.1.53530 WP_003087500.1.53586 WP_003087500.1.53663 WP_003087500.1.53678 WP_003087500.1.53719 WP_003087500.1.53932 WP_003087500.1.53946 WP_003087500.1.53951 WP_003087500.1.5399 WP_003087500.1.54003 WP_003087500.1.54076 WP_003087500.1.54146 WP_003087500.1.54293 WP_003087500.1.54354 WP_003087500.1.54571 WP_003087500.1.54742 WP_003087500.1.54809 WP_003087500.1.54974 WP_003087500.1.55 WP_003087500.1.55089 WP_003087500.1.55169 WP_003087500.1.55387 WP_003087500.1.55400 WP_003087500.1.55445 WP_003087500.1.55543 WP_003087500.1.55729 WP_003087500.1.55813 WP_003087500.1.55976 WP_003087500.1.56145 WP_003087500.1.56187 WP_003087500.1.56228 WP_003087500.1.56229 WP_003087500.1.56315 WP_003087500.1.56442 WP_003087500.1.56452 WP_003087500.1.56465 WP_003087500.1.56475 WP_003087500.1.56626 WP_003087500.1.56797 WP_003087500.1.56819 WP_003087500.1.56864 WP_003087500.1.56973 WP_003087500.1.57005 WP_003087500.1.57020 WP_003087500.1.57065 WP_003087500.1.57113 WP_003087500.1.57131 WP_003087500.1.57276 WP_003087500.1.5731 WP_003087500.1.57339 WP_003087500.1.57369 WP_003087500.1.57417 WP_003087500.1.57548 WP_003087500.1.57566 WP_003087500.1.57792 WP_003087500.1.57841 WP_003087500.1.57853 WP_003087500.1.57921 WP_003087500.1.57966 WP_003087500.1.58019 WP_003087500.1.58056 WP_003087500.1.58183 WP_003087500.1.58193 WP_003087500.1.58200 WP_003087500.1.58228 WP_003087500.1.58360 WP_003087500.1.58417 WP_003087500.1.58436 WP_003087500.1.58482 WP_003087500.1.5850 WP_003087500.1.58510 WP_003087500.1.5856 WP_003087500.1.58581 WP_003087500.1.58689 WP_003087500.1.5869 WP_003087500.1.58800 WP_003087500.1.58838 WP_003087500.1.58845 WP_003087500.1.58944 WP_003087500.1.58952 WP_003087500.1.5897 WP_003087500.1.59013 WP_003087500.1.59076 WP_003087500.1.59158 WP_003087500.1.59212 WP_003087500.1.59246 WP_003087500.1.59250 WP_003087500.1.59339 WP_003087500.1.59376 WP_003087500.1.59385 WP_003087500.1.59563 WP_003087500.1.59688 WP_003087500.1.59797 WP_003087500.1.59831 WP_003087500.1.59943 WP_003087500.1.60062 WP_003087500.1.60079 WP_003087500.1.60084 WP_003087500.1.60364 WP_003087500.1.60396 WP_003087500.1.60415 WP_003087500.1.60467 WP_003087500.1.60472 WP_003087500.1.60509 WP_003087500.1.60600 WP_003087500.1.60602 WP_003087500.1.60603 WP_003087500.1.60639 WP_003087500.1.60679 WP_003087500.1.60686 WP_003087500.1.60850 WP_003087500.1.60916 WP_003087500.1.60970 WP_003087500.1.60979 WP_003087500.1.61122 WP_003087500.1.61130 WP_003087500.1.61209 WP_003087500.1.61269 WP_003087500.1.61288 WP_003087500.1.61294 WP_003087500.1.6130 WP_003087500.1.61431 WP_003087500.1.61493 WP_003087500.1.61589 WP_003087500.1.61598 WP_003087500.1.616 WP_003087500.1.61696 WP_003087500.1.6173 WP_003087500.1.62180 WP_003087500.1.62186 WP_003087500.1.62211 WP_003087500.1.62410 WP_003087500.1.6242 WP_003087500.1.62483 WP_003087500.1.62516 WP_003087500.1.62534 WP_003087500.1.626 WP_003087500.1.62604 WP_003087500.1.62701 WP_003087500.1.62703 WP_003087500.1.62704 WP_003087500.1.62708 WP_003087500.1.62716 WP_003087500.1.62768 WP_003087500.1.62838 WP_003087500.1.62873 WP_003087500.1.62961 WP_003087500.1.62977 WP_003087500.1.63057 WP_003087500.1.63196 WP_003087500.1.63338 WP_003087500.1.63401 WP_003087500.1.63591 WP_003087500.1.63597 WP_003087500.1.63659 WP_003087500.1.63739 WP_003087500.1.63929 WP_003087500.1.63941 WP_003087500.1.63995 WP_003087500.1.64155 WP_003087500.1.64212 WP_003087500.1.64340 WP_003087500.1.6450 WP_003087500.1.64544 WP_003087500.1.64603 WP_003087500.1.64605 WP_003087500.1.6461 WP_003087500.1.64611 WP_003087500.1.64726 WP_003087500.1.64748 WP_003087500.1.64799 WP_003087500.1.64807 WP_003087500.1.64862 WP_003087500.1.64886 WP_003087500.1.64984 WP_003087500.1.65009 WP_003087500.1.65092 WP_003087500.1.65099 WP_003087500.1.65145 WP_003087500.1.65237 WP_003087500.1.65247 WP_003087500.1.65312 WP_003087500.1.65316 WP_003087500.1.65337 WP_003087500.1.65457 WP_003087500.1.65478 WP_003087500.1.65632 WP_003087500.1.65642 WP_003087500.1.65679 WP_003087500.1.65779 WP_003087500.1.65819 WP_003087500.1.65867 WP_003087500.1.6589 WP_003087500.1.65926 WP_003087500.1.66088 WP_003087500.1.66155 WP_003087500.1.6627 WP_003087500.1.6629 WP_003087500.1.66364 WP_003087500.1.66371 WP_003087500.1.66410 WP_003087500.1.66526 WP_003087500.1.66563 WP_003087500.1.66634 WP_003087500.1.66693 WP_003087500.1.66721 WP_003087500.1.66892 WP_003087500.1.66929 WP_003087500.1.66950 WP_003087500.1.66982 WP_003087500.1.67124 WP_003087500.1.67192 WP_003087500.1.67205 WP_003087500.1.67261 WP_003087500.1.67269 WP_003087500.1.67370 WP_003087500.1.67388 WP_003087500.1.67472 WP_003087500.1.67489 WP_003087500.1.67506 WP_003087500.1.67526 WP_003087500.1.67686 WP_003087500.1.67830 WP_003087500.1.67874 WP_003087500.1.67875 WP_003087500.1.67899 WP_003087500.1.67903 WP_003087500.1.67937 WP_003087500.1.67948 WP_003087500.1.6796 WP_003087500.1.68000 WP_003087500.1.68162 WP_003087500.1.68172 WP_003087500.1.68183 WP_003087500.1.68194 WP_003087500.1.68252 WP_003087500.1.68446 WP_003087500.1.68448 WP_003087500.1.68499 WP_003087500.1.6850 WP_003087500.1.68541 WP_003087500.1.68568 WP_003087500.1.68756 WP_003087500.1.68790 WP_003087500.1.68802 WP_003087500.1.68850 WP_003087500.1.68862 WP_003087500.1.68881 WP_003087500.1.68910 WP_003087500.1.68938 WP_003087500.1.68979 WP_003087500.1.69088 WP_003087500.1.69159 WP_003087500.1.69209 WP_003087500.1.69260 WP_003087500.1.6928 WP_003087500.1.69330 WP_003087500.1.69411 WP_003087500.1.69702 WP_003087500.1.69907 WP_003087500.1.69993 WP_003087500.1.70098 WP_003087500.1.70138 WP_003087500.1.70216 WP_003087500.1.70470 WP_003087500.1.70537 WP_003087500.1.70561 WP_003087500.1.70583 WP_003087500.1.70648 WP_003087500.1.70650 WP_003087500.1.7077 WP_003087500.1.70778 WP_003087500.1.71038 WP_003087500.1.71141 WP_003087500.1.71203 WP_003087500.1.71234 WP_003087500.1.71249 WP_003087500.1.71254 WP_003087500.1.7128 WP_003087500.1.71290 WP_003087500.1.71412 WP_003087500.1.71570 WP_003087500.1.71610 WP_003087500.1.7163 WP_003087500.1.71642 WP_003087500.1.71666 WP_003087500.1.71738 WP_003087500.1.71862 WP_003087500.1.71866 WP_003087500.1.71934 WP_003087500.1.72149 WP_003087500.1.72167 WP_003087500.1.72183 WP_003087500.1.7219 WP_003087500.1.72287 WP_003087500.1.72323 WP_003087500.1.72331 WP_003087500.1.72477 WP_003087500.1.72541 WP_003087500.1.72570 WP_003087500.1.72662 WP_003087500.1.72727 WP_003087500.1.7276 WP_003087500.1.72768 WP_003087500.1.72782 WP_003087500.1.72845 WP_003087500.1.72920 WP_003087500.1.73035 WP_003087500.1.73048 WP_003087500.1.7308 WP_003087500.1.73149 WP_003087500.1.73172 WP_003087500.1.73192 WP_003087500.1.7327 WP_003087500.1.73490 WP_003087500.1.73541 WP_003087500.1.73719 WP_003087500.1.73728 WP_003087500.1.7377 WP_003087500.1.73791 WP_003087500.1.7382 WP_003087500.1.73911 WP_003087500.1.74 WP_003087500.1.74072 WP_003087500.1.7408 WP_003087500.1.74106 WP_003087500.1.74167 WP_003087500.1.74182 WP_003087500.1.74219 WP_003087500.1.74281 WP_003087500.1.74287 WP_003087500.1.74326 WP_003087500.1.7445 WP_003087500.1.74458 WP_003087500.1.74473 WP_003087500.1.7448 WP_003087500.1.74518 WP_003087500.1.7456 WP_003087500.1.74568 WP_003087500.1.74637 WP_003087500.1.74685 WP_003087500.1.748 WP_003087500.1.74878 WP_003087500.1.74941 WP_003087500.1.74958 WP_003087500.1.7501 WP_003087500.1.75041 WP_003087500.1.75119 WP_003087500.1.75389 WP_003087500.1.75431 WP_003087500.1.7547 WP_003087500.1.75549 WP_003087500.1.75573 WP_003087500.1.75580 WP_003087500.1.75603 WP_003087500.1.75631 WP_003087500.1.7568 WP_003087500.1.75756 WP_003087500.1.75771 WP_003087500.1.75792 WP_003087500.1.75825 WP_003087500.1.75826 WP_003087500.1.75947 WP_003087500.1.7595 WP_003087500.1.76077 WP_003087500.1.76092 WP_003087500.1.76141 WP_003087500.1.76322 WP_003087500.1.76355 WP_003087500.1.76383 WP_003087500.1.76399 WP_003087500.1.76467 WP_003087500.1.76484 WP_003087500.1.76600 WP_003087500.1.76716 WP_003087500.1.76775 WP_003087500.1.76791 WP_003087500.1.76861 WP_003087500.1.77235 WP_003087500.1.77238 WP_003087500.1.77286 WP_003087500.1.77317 WP_003087500.1.77442 WP_003087500.1.77566 WP_003087500.1.77587 WP_003087500.1.77750 WP_003087500.1.77769 WP_003087500.1.77834 WP_003087500.1.78104 WP_003087500.1.78118 WP_003087500.1.78134 WP_003087500.1.78148 WP_003087500.1.78280 WP_003087500.1.78288 WP_003087500.1.7840 WP_003087500.1.78409 WP_003087500.1.78425 WP_003087500.1.78430 WP_003087500.1.78570 WP_003087500.1.78599 WP_003087500.1.788 WP_003087500.1.78810 WP_003087500.1.78947 WP_003087500.1.78954 WP_003087500.1.78986 WP_003087500.1.7899 WP_003087500.1.79003 WP_003087500.1.79007 WP_003087500.1.79053 WP_003087500.1.79060 WP_003087500.1.79256 WP_003087500.1.79286 WP_003087500.1.79311 WP_003087500.1.79364 WP_003087500.1.79421 WP_003087500.1.7945 WP_003087500.1.7953 WP_003087500.1.79569 WP_003087500.1.79754 WP_003087500.1.79788 WP_003087500.1.79883 WP_003087500.1.799 WP_003087500.1.79902 WP_003087500.1.79908 WP_003087500.1.79986 WP_003087500.1.8 WP_003087500.1.80033 WP_003087500.1.80087 WP_003087500.1.80102 WP_003087500.1.8013 WP_003087500.1.80174 WP_003087500.1.80258 WP_003087500.1.8028 WP_003087500.1.8038 WP_003087500.1.80410 WP_003087500.1.80411 WP_003087500.1.80454 WP_003087500.1.80481 WP_003087500.1.8051 WP_003087500.1.80572 WP_003087500.1.80627 WP_003087500.1.8064 WP_003087500.1.80645 WP_003087500.1.80683 WP_003087500.1.80715 WP_003087500.1.80720 WP_003087500.1.80785 WP_003087500.1.80880 WP_003087500.1.80910 WP_003087500.1.80926 WP_003087500.1.80938 WP_003087500.1.80969 WP_003087500.1.81081 WP_003087500.1.81082 WP_003087500.1.8110 WP_003087500.1.81206 WP_003087500.1.81331 WP_003087500.1.81338 WP_003087500.1.81349 WP_003087500.1.81368 WP_003087500.1.81380 WP_003087500.1.8141 WP_003087500.1.81426 WP_003087500.1.81470 WP_003087500.1.81487 WP_003087500.1.81708 WP_003087500.1.81816 WP_003087500.1.81844 WP_003087500.1.81856 WP_003087500.1.81874 WP_003087500.1.81927 WP_003087500.1.81950 WP_003087500.1.81957 WP_003087500.1.81960 WP_003087500.1.81986 WP_003087500.1.82117 WP_003087500.1.82127 WP_003087500.1.82260 WP_003087500.1.82312 WP_003087500.1.8238 WP_003087500.1.82643 WP_003087500.1.82686 WP_003087500.1.82798 WP_003087500.1.82810 WP_003087500.1.82882 WP_003087500.1.82936 WP_003087500.1.83131 WP_003087500.1.83184 WP_003087500.1.83213 WP_003087500.1.83251 WP_003087500.1.83296 WP_003087500.1.83317 WP_003087500.1.83374 WP_003087500.1.83394 WP_003087500.1.83440 WP_003087500.1.83460 WP_003087500.1.835 WP_003087500.1.83503 WP_003087500.1.8351 WP_003087500.1.83540 WP_003087500.1.83637 WP_003087500.1.83673 WP_003087500.1.83698 WP_003087500.1.83871 WP_003087500.1.83937 WP_003087500.1.84008 WP_003087500.1.84138 WP_003087500.1.84177 WP_003087500.1.84190 WP_003087500.1.84271 WP_003087500.1.84297 WP_003087500.1.8437 WP_003087500.1.84374 WP_003087500.1.84398 WP_003087500.1.84404 WP_003087500.1.84526 WP_003087500.1.8453 WP_003087500.1.84558 WP_003087500.1.84674 WP_003087500.1.84684 WP_003087500.1.84754 WP_003087500.1.84792 WP_003087500.1.84825 WP_003087500.1.84865 WP_003087500.1.84937 WP_003087500.1.85028 WP_003087500.1.85150 WP_003087500.1.85220 WP_003087500.1.85311 WP_003087500.1.85318 WP_003087500.1.85453 WP_003087500.1.85638 WP_003087500.1.85788 WP_003087500.1.85897 WP_003087500.1.85910 WP_003087500.1.85920 WP_003087500.1.85978 WP_003087500.1.86047 WP_003087500.1.86058 WP_003087500.1.861 WP_003087500.1.86125 WP_003087500.1.86182 WP_003087500.1.86243 WP_003087500.1.86278 WP_003087500.1.86293 WP_003087500.1.86432 WP_003087500.1.8645 WP_003087500.1.865 WP_003087500.1.86506 WP_003087500.1.86545 WP_003087500.1.86552 WP_003087500.1.86554 WP_003087500.1.86595 WP_003087500.1.86665 WP_003087500.1.86785 WP_003087500.1.86796 WP_003087500.1.86813 WP_003087500.1.86822 WP_003087500.1.8693 WP_003087500.1.86970 WP_003087500.1.86985 WP_003087500.1.87104 WP_003087500.1.87163 WP_003087500.1.8718 WP_003087500.1.87316 WP_003087500.1.87435 WP_003087500.1.87463 WP_003087500.1.87530 WP_003087500.1.87547 WP_003087500.1.8777 WP_003087500.1.8785 WP_003087500.1.87877 WP_003087500.1.87888 WP_003087500.1.87970 WP_003087500.1.87975 WP_003087500.1.87981 WP_003087500.1.88004 WP_003087500.1.88308 WP_003087500.1.88415 WP_003087500.1.88540 WP_003087500.1.88550 WP_003087500.1.88578 WP_003087500.1.88605 WP_003087500.1.88714 WP_003087500.1.88796 WP_003087500.1.889 WP_003087500.1.8911 WP_003087500.1.89245 WP_003087500.1.89330 WP_003087500.1.89434 WP_003087500.1.89480 WP_003087500.1.89491 WP_003087500.1.89523 WP_003087500.1.89577 WP_003087500.1.89610 WP_003087500.1.89638 WP_003087500.1.89662 WP_003087500.1.89736 WP_003087500.1.8976 WP_003087500.1.89805 WP_003087500.1.89866 WP_003087500.1.89868 WP_003087500.1.89871 WP_003087500.1.89886 WP_003087500.1.89992 WP_003087500.1.90032 WP_003087500.1.90141 WP_003087500.1.90150 WP_003087500.1.90225 WP_003087500.1.90242 WP_003087500.1.90272 WP_003087500.1.90306 WP_003087500.1.90412 WP_003087500.1.90569 WP_003087500.1.91012 WP_003087500.1.91093 WP_003087500.1.9120 WP_003087500.1.91204 WP_003087500.1.91236 WP_003087500.1.91281 WP_003087500.1.91307 WP_003087500.1.91392 WP_003087500.1.9143 WP_003087500.1.91431 WP_003087500.1.91467 WP_003087500.1.91527 WP_003087500.1.91796 WP_003087500.1.9182 WP_003087500.1.91846 WP_003087500.1.91882 WP_003087500.1.9219 WP_003087500.1.92573 WP_003087500.1.92585 WP_003087500.1.92589 WP_003087500.1.92594 WP_003087500.1.92624 WP_003087500.1.92630 WP_003087500.1.9272 WP_003087500.1.92759 WP_003087500.1.92769 WP_003087500.1.92847 WP_003087500.1.92930 WP_003087500.1.93090 WP_003087500.1.93122 WP_003087500.1.93148 WP_003087500.1.93196 WP_003087500.1.93264 WP_003087500.1.9328 WP_003087500.1.93493 WP_003087500.1.93498 WP_003087500.1.93520 WP_003087500.1.93568 WP_003087500.1.93797 WP_003087500.1.93889 WP_003087500.1.94004 WP_003087500.1.94031 WP_003087500.1.94065 WP_003087500.1.94078 WP_003087500.1.94174 WP_003087500.1.94218 WP_003087500.1.94221 WP_003087500.1.94230 WP_003087500.1.94243 WP_003087500.1.94288 WP_003087500.1.94333 WP_003087500.1.94349 WP_003087500.1.94385 WP_003087500.1.94434 WP_003087500.1.9444 WP_003087500.1.94682 WP_003087500.1.94732 WP_003087500.1.94742 WP_003087500.1.94818 WP_003087500.1.94856 WP_003087500.1.94874 WP_003087500.1.94881 WP_003087500.1.94897 WP_003087500.1.94943 WP_003087500.1.95018 WP_003087500.1.95025 WP_003087500.1.95027 WP_003087500.1.95056 WP_003087500.1.95117 WP_003087500.1.95132 WP_003087500.1.95187 WP_003087500.1.95207 WP_003087500.1.95217 WP_003087500.1.95354 WP_003087500.1.95460 WP_003087500.1.95525 WP_003087500.1.95536 WP_003087500.1.95668 WP_003087500.1.95745 WP_003087500.1.95751 WP_003087500.1.95774 WP_003087500.1.95782 WP_003087500.1.95787 WP_003087500.1.95802 WP_003087500.1.95820 WP_003087500.1.95825 WP_003087500.1.95959 WP_003087500.1.9599 WP_003087500.1.95994 WP_003087500.1.95999 WP_003087500.1.9604 WP_003087500.1.96058 WP_003087500.1.961 WP_003087500.1.96134 WP_003087500.1.96193 WP_003087500.1.96243 WP_003087500.1.96267 WP_003087500.1.96434 WP_003087500.1.96702 WP_003087500.1.96863 WP_003087500.1.97118 WP_003087500.1.97126 WP_003087500.1.97204 WP_003087500.1.97213 WP_003087500.1.9722 WP_003087500.1.97271 WP_003087500.1.97272 WP_003087500.1.97377 WP_003087500.1.97461 WP_003087500.1.97474 WP_003087500.1.97488 WP_003087500.1.97499 WP_003087500.1.97503 WP_003087500.1.97521 WP_003087500.1.97583 WP_003087500.1.97614 WP_003087500.1.97784 WP_003087500.1.97968 WP_003087500.1.98111 WP_003087500.1.98260 WP_003087500.1.98410 WP_003087500.1.98414 WP_003087500.1.9845 WP_003087500.1.985 WP_003087500.1.98522 WP_003087500.1.98610 WP_003087500.1.98814 WP_003087500.1.98873 WP_003087500.1.98958 WP_003087500.1.98963 WP_003087500.1.99065 WP_003087500.1.99068 WP_003087500.1.99103 WP_003087500.1.99353 WP_003087500.1.99378 WP_003087500.1.99386 WP_003087500.1.99443 WP_003087500.1.99461 WP_003087500.1.99647 WP_003087500.1.99757 WP_003087500.1.99772 WP_003087500.1.99795 gi|558677445|ref|YP_008814153.1| gi|558671094|ref|YP_008807804.1| gi|386065453|ref|YP_005980757.1| gi|386059487|ref|YP_005976009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]