SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155031|ref|YP_008944017.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155031|ref|YP_008944017.1|
Domain Number 1 Region: 22-241
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 1.14e-50
Family Cation efflux protein transmembrane domain-like 0.0073
Further Details:      
 
Weak hits

Sequence:  gi|568155031|ref|YP_008944017.1|
Domain Number - Region: 245-314
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0719
Family Cation efflux protein cytoplasmic domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568155031|ref|YP_008944017.1|
Sequence length 320
Comment cation transporter [Pseudomonas aeruginosa LES431]
Sequence
MPGTPTTQPLRHSHRFDQGNPLAERNTRWAVLLTACMMVAEIAGGWLFNSMALLADGWHM
SSHALALGLAVLAYGAARRYANDPRFSFGTWKIEVLGSYTSALLLLLVAGLMLYQSVERL
LDPSPIHYQQAMLVAALGLLVNLACAWLLRDGHAHHGHGHSHHHHHHHHDHHAHRHDLNL
RAAYLHVLADAATSLLAIVALAGGLLWNAAWLDPLMGIVGAVLVSVWACGLIRQSSRVLL
DAQMDAPVAAEIRAAIASSPLPAELLDLHLWQVGQGKYACLLSLLTTEEGSADYFKRRLA
EHEELVHITVEVNPLLPLAA
Download sequence
Identical sequences A0A0H3R356 A0A1E9CM63
557722.PLES_38851 gi|392985219|ref|YP_006483806.1| WP_003116040.1.101809 WP_003116040.1.10407 WP_003116040.1.11026 WP_003116040.1.11943 WP_003116040.1.12530 WP_003116040.1.13232 WP_003116040.1.14714 WP_003116040.1.1475 WP_003116040.1.20342 WP_003116040.1.21469 WP_003116040.1.21517 WP_003116040.1.22863 WP_003116040.1.23195 WP_003116040.1.23611 WP_003116040.1.23715 WP_003116040.1.24351 WP_003116040.1.24662 WP_003116040.1.251 WP_003116040.1.25142 WP_003116040.1.2652 WP_003116040.1.27837 WP_003116040.1.29179 WP_003116040.1.29577 WP_003116040.1.30254 WP_003116040.1.31076 WP_003116040.1.31279 WP_003116040.1.31741 WP_003116040.1.32544 WP_003116040.1.32869 WP_003116040.1.33210 WP_003116040.1.34191 WP_003116040.1.34832 WP_003116040.1.34901 WP_003116040.1.35036 WP_003116040.1.35857 WP_003116040.1.3653 WP_003116040.1.37125 WP_003116040.1.3833 WP_003116040.1.39088 WP_003116040.1.39811 WP_003116040.1.40950 WP_003116040.1.41625 WP_003116040.1.4190 WP_003116040.1.42643 WP_003116040.1.42952 WP_003116040.1.43662 WP_003116040.1.45090 WP_003116040.1.45146 WP_003116040.1.45485 WP_003116040.1.45934 WP_003116040.1.46152 WP_003116040.1.47774 WP_003116040.1.48820 WP_003116040.1.50682 WP_003116040.1.50989 WP_003116040.1.51267 WP_003116040.1.51943 WP_003116040.1.52355 WP_003116040.1.52690 WP_003116040.1.53351 WP_003116040.1.5427 WP_003116040.1.56797 WP_003116040.1.56819 WP_003116040.1.57480 WP_003116040.1.58228 WP_003116040.1.59076 WP_003116040.1.60415 WP_003116040.1.60603 WP_003116040.1.60686 WP_003116040.1.61696 WP_003116040.1.62410 WP_003116040.1.62516 WP_003116040.1.62534 WP_003116040.1.62701 WP_003116040.1.6283 WP_003116040.1.63196 WP_003116040.1.64433 WP_003116040.1.64748 WP_003116040.1.65099 WP_003116040.1.65549 WP_003116040.1.6589 WP_003116040.1.66526 WP_003116040.1.67388 WP_003116040.1.67545 WP_003116040.1.67686 WP_003116040.1.67948 WP_003116040.1.68862 WP_003116040.1.72331 WP_003116040.1.73149 WP_003116040.1.74604 WP_003116040.1.7547 WP_003116040.1.76484 WP_003116040.1.78430 WP_003116040.1.78810 WP_003116040.1.78954 WP_003116040.1.79986 WP_003116040.1.80938 WP_003116040.1.8110 WP_003116040.1.82882 WP_003116040.1.84374 WP_003116040.1.86287 WP_003116040.1.86545 WP_003116040.1.8718 WP_003116040.1.87435 WP_003116040.1.87530 WP_003116040.1.91431 WP_003116040.1.92585 WP_003116040.1.92624 WP_003116040.1.92769 WP_003116040.1.9349 WP_003116040.1.94218 WP_003116040.1.94897 WP_003116040.1.9722 WP_003116040.1.98926 WP_003116040.1.99461 WP_003116040.1.99757 gi|568155031|ref|YP_008944017.1| gi|218892599|ref|YP_002441468.1| gi|514408792|ref|YP_008131857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]