SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155317|ref|YP_008944306.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155317|ref|YP_008944306.1|
Domain Number 1 Region: 27-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-134
Family Exotoxin A, N-terminal domain 0.000000000303
Further Details:      
 
Domain Number 2 Region: 420-631
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.12e-80
Family ADP-ribosylating toxins 0.00000000231
Further Details:      
 
Domain Number 3 Region: 277-419
Classification Level Classification E-value
Superfamily Exotoxin A, middle domain 4.97e-70
Family Exotoxin A, middle domain 0.0000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568155317|ref|YP_008944306.1|
Sequence length 638
Comment exotoxin A [Pseudomonas aeruginosa LES431]
Sequence
MHLIPHWIPLVASLGLLAGGSSASAAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIA
DPNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARG
SWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRA
HESNEMQPTLAISHAGVSVVMAQAQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCK
LDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRH
RQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQ
ARLALTLAAAESERFVRQGTGNDEAGAASADVVSLTCPVAAGECAGPADSGDALLERNYP
TGAEFLGNGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGV
RARSQDLDAIWRGFYIAGDPELAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTG
LTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERTVVIPSAIPTDP
RNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK
Download sequence
Identical sequences WP_012614391.1.11026 WP_012614391.1.11943 WP_012614391.1.13232 WP_012614391.1.14714 WP_012614391.1.1475 WP_012614391.1.21517 WP_012614391.1.22863 WP_012614391.1.23195 WP_012614391.1.23715 WP_012614391.1.24351 WP_012614391.1.251 WP_012614391.1.25142 WP_012614391.1.27837 WP_012614391.1.31279 WP_012614391.1.32544 WP_012614391.1.33210 WP_012614391.1.34832 WP_012614391.1.35857 WP_012614391.1.3833 WP_012614391.1.38502 WP_012614391.1.39088 WP_012614391.1.43662 WP_012614391.1.45090 WP_012614391.1.45485 WP_012614391.1.45934 WP_012614391.1.46152 WP_012614391.1.47774 WP_012614391.1.52690 WP_012614391.1.56797 WP_012614391.1.59076 WP_012614391.1.60415 WP_012614391.1.60603 WP_012614391.1.62516 WP_012614391.1.62534 WP_012614391.1.62701 WP_012614391.1.65099 WP_012614391.1.66526 WP_012614391.1.67388 WP_012614391.1.67686 WP_012614391.1.68862 WP_012614391.1.72331 WP_012614391.1.73149 WP_012614391.1.7547 WP_012614391.1.78430 WP_012614391.1.84374 WP_012614391.1.86545 WP_012614391.1.87435 WP_012614391.1.91431 WP_012614391.1.92624 WP_012614391.1.92769 WP_012614391.1.95460 WP_012614391.1.9722 WP_012614391.1.99757 557722.PLES_41711 gi|568155317|ref|YP_008944306.1| gi|218892886|ref|YP_002441755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]