SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155434|ref|YP_008944423.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155434|ref|YP_008944423.1|
Domain Number 1 Region: 78-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.78e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.77e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568155434|ref|YP_008944423.1|
Sequence length 213
Comment glutathione S-transferase [Pseudomonas aeruginosa LES431]
Sequence
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLDQRLADRAFVAGDDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPK
Download sequence
Identical sequences A0A0F6RU36 A0A0H3R3T6 A0A1C7BNR7 A0A1F0IYA1 A0A1S1C3L2 Q9I4U1
gi|568155434|ref|YP_008944423.1| gi|392985490|ref|YP_006484077.1| 208964.PA1033 557722.PLES_42901 gi|15596230|ref|NP_249724.1| NP_249724.1.87394 WP_003112525.1.100179 WP_003112525.1.100394 WP_003112525.1.100473 WP_003112525.1.100654 WP_003112525.1.100723 WP_003112525.1.100777 WP_003112525.1.100786 WP_003112525.1.100808 WP_003112525.1.100809 WP_003112525.1.100872 WP_003112525.1.100983 WP_003112525.1.101021 WP_003112525.1.101572 WP_003112525.1.101642 WP_003112525.1.101712 WP_003112525.1.101809 WP_003112525.1.101863 WP_003112525.1.101871 WP_003112525.1.10202 WP_003112525.1.10228 WP_003112525.1.10257 WP_003112525.1.1037 WP_003112525.1.10407 WP_003112525.1.10419 WP_003112525.1.10468 WP_003112525.1.10477 WP_003112525.1.10482 WP_003112525.1.10513 WP_003112525.1.10529 WP_003112525.1.10636 WP_003112525.1.10684 WP_003112525.1.10856 WP_003112525.1.10901 WP_003112525.1.10949 WP_003112525.1.11026 WP_003112525.1.1109 WP_003112525.1.11178 WP_003112525.1.11381 WP_003112525.1.11388 WP_003112525.1.11410 WP_003112525.1.11454 WP_003112525.1.11568 WP_003112525.1.11569 WP_003112525.1.11854 WP_003112525.1.11943 WP_003112525.1.12018 WP_003112525.1.12120 WP_003112525.1.12240 WP_003112525.1.12354 WP_003112525.1.12561 WP_003112525.1.12657 WP_003112525.1.12670 WP_003112525.1.12687 WP_003112525.1.12797 WP_003112525.1.13092 WP_003112525.1.13232 WP_003112525.1.13242 WP_003112525.1.13407 WP_003112525.1.13529 WP_003112525.1.13758 WP_003112525.1.13785 WP_003112525.1.13828 WP_003112525.1.13865 WP_003112525.1.1393 WP_003112525.1.14049 WP_003112525.1.14078 WP_003112525.1.14204 WP_003112525.1.14378 WP_003112525.1.14424 WP_003112525.1.14460 WP_003112525.1.14463 WP_003112525.1.14615 WP_003112525.1.14714 WP_003112525.1.1475 WP_003112525.1.14754 WP_003112525.1.14797 WP_003112525.1.14966 WP_003112525.1.15004 WP_003112525.1.152 WP_003112525.1.15231 WP_003112525.1.15297 WP_003112525.1.15480 WP_003112525.1.15482 WP_003112525.1.15606 WP_003112525.1.15886 WP_003112525.1.15889 WP_003112525.1.15934 WP_003112525.1.16074 WP_003112525.1.16142 WP_003112525.1.16161 WP_003112525.1.16197 WP_003112525.1.16239 WP_003112525.1.16267 WP_003112525.1.16419 WP_003112525.1.1646 WP_003112525.1.16660 WP_003112525.1.16782 WP_003112525.1.16788 WP_003112525.1.16801 WP_003112525.1.16895 WP_003112525.1.17022 WP_003112525.1.17155 WP_003112525.1.17162 WP_003112525.1.172 WP_003112525.1.17354 WP_003112525.1.17370 WP_003112525.1.17397 WP_003112525.1.18052 WP_003112525.1.18199 WP_003112525.1.18204 WP_003112525.1.18234 WP_003112525.1.18493 WP_003112525.1.18653 WP_003112525.1.18728 WP_003112525.1.18735 WP_003112525.1.18769 WP_003112525.1.18892 WP_003112525.1.18911 WP_003112525.1.19251 WP_003112525.1.19269 WP_003112525.1.19376 WP_003112525.1.1938 WP_003112525.1.19552 WP_003112525.1.19591 WP_003112525.1.19703 WP_003112525.1.19711 WP_003112525.1.19741 WP_003112525.1.19824 WP_003112525.1.19931 WP_003112525.1.20070 WP_003112525.1.20134 WP_003112525.1.20154 WP_003112525.1.20216 WP_003112525.1.20342 WP_003112525.1.20854 WP_003112525.1.21100 WP_003112525.1.21166 WP_003112525.1.21209 WP_003112525.1.21358 WP_003112525.1.2144 WP_003112525.1.21460 WP_003112525.1.21469 WP_003112525.1.21471 WP_003112525.1.21517 WP_003112525.1.21767 WP_003112525.1.21782 WP_003112525.1.21801 WP_003112525.1.21863 WP_003112525.1.21871 WP_003112525.1.21891 WP_003112525.1.221 WP_003112525.1.22316 WP_003112525.1.22324 WP_003112525.1.22389 WP_003112525.1.22442 WP_003112525.1.22477 WP_003112525.1.22491 WP_003112525.1.22573 WP_003112525.1.22671 WP_003112525.1.22704 WP_003112525.1.22729 WP_003112525.1.22863 WP_003112525.1.23013 WP_003112525.1.23195 WP_003112525.1.23331 WP_003112525.1.23394 WP_003112525.1.23418 WP_003112525.1.23512 WP_003112525.1.23525 WP_003112525.1.236 WP_003112525.1.23611 WP_003112525.1.23715 WP_003112525.1.23769 WP_003112525.1.23794 WP_003112525.1.23925 WP_003112525.1.23967 WP_003112525.1.23983 WP_003112525.1.24087 WP_003112525.1.24101 WP_003112525.1.24351 WP_003112525.1.2453 WP_003112525.1.24662 WP_003112525.1.24862 WP_003112525.1.24869 WP_003112525.1.24879 WP_003112525.1.24938 WP_003112525.1.25052 WP_003112525.1.251 WP_003112525.1.25142 WP_003112525.1.25191 WP_003112525.1.25271 WP_003112525.1.2529 WP_003112525.1.25328 WP_003112525.1.25344 WP_003112525.1.25477 WP_003112525.1.25600 WP_003112525.1.25675 WP_003112525.1.2572 WP_003112525.1.25903 WP_003112525.1.2596 WP_003112525.1.26042 WP_003112525.1.26301 WP_003112525.1.26334 WP_003112525.1.26428 WP_003112525.1.26489 WP_003112525.1.2652 WP_003112525.1.26604 WP_003112525.1.26681 WP_003112525.1.26682 WP_003112525.1.26705 WP_003112525.1.26816 WP_003112525.1.26841 WP_003112525.1.2698 WP_003112525.1.27039 WP_003112525.1.27107 WP_003112525.1.27218 WP_003112525.1.27259 WP_003112525.1.27587 WP_003112525.1.27687 WP_003112525.1.27772 WP_003112525.1.27825 WP_003112525.1.27837 WP_003112525.1.27966 WP_003112525.1.28064 WP_003112525.1.28078 WP_003112525.1.28136 WP_003112525.1.28175 WP_003112525.1.28258 WP_003112525.1.283 WP_003112525.1.28316 WP_003112525.1.28372 WP_003112525.1.28382 WP_003112525.1.28383 WP_003112525.1.28404 WP_003112525.1.28505 WP_003112525.1.28560 WP_003112525.1.28623 WP_003112525.1.28800 WP_003112525.1.28823 WP_003112525.1.28920 WP_003112525.1.29096 WP_003112525.1.29137 WP_003112525.1.29158 WP_003112525.1.29472 WP_003112525.1.2948 WP_003112525.1.29501 WP_003112525.1.29577 WP_003112525.1.29668 WP_003112525.1.2980 WP_003112525.1.29848 WP_003112525.1.29920 WP_003112525.1.30081 WP_003112525.1.30120 WP_003112525.1.30365 WP_003112525.1.30474 WP_003112525.1.30475 WP_003112525.1.30614 WP_003112525.1.30625 WP_003112525.1.30740 WP_003112525.1.30797 WP_003112525.1.30815 WP_003112525.1.31279 WP_003112525.1.31361 WP_003112525.1.31587 WP_003112525.1.31741 WP_003112525.1.31852 WP_003112525.1.32134 WP_003112525.1.32137 WP_003112525.1.32289 WP_003112525.1.32314 WP_003112525.1.32447 WP_003112525.1.32523 WP_003112525.1.32544 WP_003112525.1.32596 WP_003112525.1.32637 WP_003112525.1.32711 WP_003112525.1.32869 WP_003112525.1.33097 WP_003112525.1.33186 WP_003112525.1.33204 WP_003112525.1.33210 WP_003112525.1.33340 WP_003112525.1.33387 WP_003112525.1.3351 WP_003112525.1.33517 WP_003112525.1.33523 WP_003112525.1.33653 WP_003112525.1.33774 WP_003112525.1.33801 WP_003112525.1.34039 WP_003112525.1.34143 WP_003112525.1.34151 WP_003112525.1.34324 WP_003112525.1.3452 WP_003112525.1.34568 WP_003112525.1.34670 WP_003112525.1.34832 WP_003112525.1.34837 WP_003112525.1.34876 WP_003112525.1.34878 WP_003112525.1.34901 WP_003112525.1.34922 WP_003112525.1.34942 WP_003112525.1.35036 WP_003112525.1.35104 WP_003112525.1.35149 WP_003112525.1.35231 WP_003112525.1.35281 WP_003112525.1.35353 WP_003112525.1.3540 WP_003112525.1.35431 WP_003112525.1.35480 WP_003112525.1.35512 WP_003112525.1.35669 WP_003112525.1.3568 WP_003112525.1.35762 WP_003112525.1.35857 WP_003112525.1.35984 WP_003112525.1.36487 WP_003112525.1.36521 WP_003112525.1.3653 WP_003112525.1.36608 WP_003112525.1.3662 WP_003112525.1.36665 WP_003112525.1.3672 WP_003112525.1.36879 WP_003112525.1.37097 WP_003112525.1.37125 WP_003112525.1.37172 WP_003112525.1.37208 WP_003112525.1.37512 WP_003112525.1.3781 WP_003112525.1.37818 WP_003112525.1.37826 WP_003112525.1.3785 WP_003112525.1.3792 WP_003112525.1.38087 WP_003112525.1.38186 WP_003112525.1.38319 WP_003112525.1.3833 WP_003112525.1.38337 WP_003112525.1.38406 WP_003112525.1.38450 WP_003112525.1.38502 WP_003112525.1.38657 WP_003112525.1.3870 WP_003112525.1.38727 WP_003112525.1.38834 WP_003112525.1.3887 WP_003112525.1.38971 WP_003112525.1.39046 WP_003112525.1.39088 WP_003112525.1.39122 WP_003112525.1.39326 WP_003112525.1.39345 WP_003112525.1.39537 WP_003112525.1.39811 WP_003112525.1.39949 WP_003112525.1.40059 WP_003112525.1.40207 WP_003112525.1.40213 WP_003112525.1.40513 WP_003112525.1.40595 WP_003112525.1.40703 WP_003112525.1.40874 WP_003112525.1.40994 WP_003112525.1.41412 WP_003112525.1.41492 WP_003112525.1.41502 WP_003112525.1.4156 WP_003112525.1.41624 WP_003112525.1.41692 WP_003112525.1.41725 WP_003112525.1.41773 WP_003112525.1.41871 WP_003112525.1.41939 WP_003112525.1.42041 WP_003112525.1.42259 WP_003112525.1.42294 WP_003112525.1.42508 WP_003112525.1.42643 WP_003112525.1.42696 WP_003112525.1.42754 WP_003112525.1.42854 WP_003112525.1.42917 WP_003112525.1.42946 WP_003112525.1.42952 WP_003112525.1.42973 WP_003112525.1.43022 WP_003112525.1.43049 WP_003112525.1.43106 WP_003112525.1.43107 WP_003112525.1.43315 WP_003112525.1.43330 WP_003112525.1.43356 WP_003112525.1.4348 WP_003112525.1.43593 WP_003112525.1.43662 WP_003112525.1.43783 WP_003112525.1.43802 WP_003112525.1.43811 WP_003112525.1.44094 WP_003112525.1.44563 WP_003112525.1.44565 WP_003112525.1.44760 WP_003112525.1.4493 WP_003112525.1.45090 WP_003112525.1.45202 WP_003112525.1.4522 WP_003112525.1.45228 WP_003112525.1.45312 WP_003112525.1.4532 WP_003112525.1.45328 WP_003112525.1.45358 WP_003112525.1.45478 WP_003112525.1.45485 WP_003112525.1.45837 WP_003112525.1.45934 WP_003112525.1.45961 WP_003112525.1.46010 WP_003112525.1.46032 WP_003112525.1.46093 WP_003112525.1.46152 WP_003112525.1.46200 WP_003112525.1.46436 WP_003112525.1.46502 WP_003112525.1.46633 WP_003112525.1.46846 WP_003112525.1.46866 WP_003112525.1.4699 WP_003112525.1.47150 WP_003112525.1.47251 WP_003112525.1.4726 WP_003112525.1.47312 WP_003112525.1.47469 WP_003112525.1.47598 WP_003112525.1.47774 WP_003112525.1.47930 WP_003112525.1.47934 WP_003112525.1.48024 WP_003112525.1.48094 WP_003112525.1.48141 WP_003112525.1.48172 WP_003112525.1.48321 WP_003112525.1.48382 WP_003112525.1.48413 WP_003112525.1.48474 WP_003112525.1.48545 WP_003112525.1.48747 WP_003112525.1.48870 WP_003112525.1.48961 WP_003112525.1.4913 WP_003112525.1.49184 WP_003112525.1.49277 WP_003112525.1.49286 WP_003112525.1.49293 WP_003112525.1.49360 WP_003112525.1.49416 WP_003112525.1.49500 WP_003112525.1.49557 WP_003112525.1.49833 WP_003112525.1.49976 WP_003112525.1.49988 WP_003112525.1.50180 WP_003112525.1.50567 WP_003112525.1.50653 WP_003112525.1.50665 WP_003112525.1.50734 WP_003112525.1.50814 WP_003112525.1.50967 WP_003112525.1.50989 WP_003112525.1.51183 WP_003112525.1.51267 WP_003112525.1.51273 WP_003112525.1.51457 WP_003112525.1.51501 WP_003112525.1.51538 WP_003112525.1.51549 WP_003112525.1.51585 WP_003112525.1.51733 WP_003112525.1.51889 WP_003112525.1.51917 WP_003112525.1.51943 WP_003112525.1.51976 WP_003112525.1.52043 WP_003112525.1.52146 WP_003112525.1.52152 WP_003112525.1.52334 WP_003112525.1.52355 WP_003112525.1.5260 WP_003112525.1.52690 WP_003112525.1.52810 WP_003112525.1.53070 WP_003112525.1.53267 WP_003112525.1.53287 WP_003112525.1.53351 WP_003112525.1.53486 WP_003112525.1.53530 WP_003112525.1.53663 WP_003112525.1.53719 WP_003112525.1.53726 WP_003112525.1.53826 WP_003112525.1.5388 WP_003112525.1.53948 WP_003112525.1.5399 WP_003112525.1.54078 WP_003112525.1.54090 WP_003112525.1.54133 WP_003112525.1.54146 WP_003112525.1.54248 WP_003112525.1.5427 WP_003112525.1.54462 WP_003112525.1.54497 WP_003112525.1.54742 WP_003112525.1.54974 WP_003112525.1.55347 WP_003112525.1.55400 WP_003112525.1.55478 WP_003112525.1.55543 WP_003112525.1.55729 WP_003112525.1.55976 WP_003112525.1.56145 WP_003112525.1.56171 WP_003112525.1.56187 WP_003112525.1.56188 WP_003112525.1.56196 WP_003112525.1.56228 WP_003112525.1.56229 WP_003112525.1.56348 WP_003112525.1.56452 WP_003112525.1.56632 WP_003112525.1.56745 WP_003112525.1.56797 WP_003112525.1.56808 WP_003112525.1.56896 WP_003112525.1.57005 WP_003112525.1.57113 WP_003112525.1.57131 WP_003112525.1.57140 WP_003112525.1.57460 WP_003112525.1.57477 WP_003112525.1.57566 WP_003112525.1.57839 WP_003112525.1.58019 WP_003112525.1.58155 WP_003112525.1.58162 WP_003112525.1.58228 WP_003112525.1.58294 WP_003112525.1.58527 WP_003112525.1.58785 WP_003112525.1.58838 WP_003112525.1.58845 WP_003112525.1.59013 WP_003112525.1.59076 WP_003112525.1.59156 WP_003112525.1.59176 WP_003112525.1.59246 WP_003112525.1.59249 WP_003112525.1.59250 WP_003112525.1.59288 WP_003112525.1.5937 WP_003112525.1.594 WP_003112525.1.59469 WP_003112525.1.59563 WP_003112525.1.59688 WP_003112525.1.59724 WP_003112525.1.59831 WP_003112525.1.60051 WP_003112525.1.60062 WP_003112525.1.60082 WP_003112525.1.60415 WP_003112525.1.60467 WP_003112525.1.60600 WP_003112525.1.60603 WP_003112525.1.61122 WP_003112525.1.61191 WP_003112525.1.61222 WP_003112525.1.61299 WP_003112525.1.61366 WP_003112525.1.61431 WP_003112525.1.61549 WP_003112525.1.61696 WP_003112525.1.6173 WP_003112525.1.62180 WP_003112525.1.62186 WP_003112525.1.62211 WP_003112525.1.62357 WP_003112525.1.62396 WP_003112525.1.62410 WP_003112525.1.6242 WP_003112525.1.62516 WP_003112525.1.62534 WP_003112525.1.62701 WP_003112525.1.62704 WP_003112525.1.62716 WP_003112525.1.6280 WP_003112525.1.63041 WP_003112525.1.63057 WP_003112525.1.63193 WP_003112525.1.63338 WP_003112525.1.63369 WP_003112525.1.63659 WP_003112525.1.63784 WP_003112525.1.63995 WP_003112525.1.64329 WP_003112525.1.64433 WP_003112525.1.64603 WP_003112525.1.64726 WP_003112525.1.64748 WP_003112525.1.64799 WP_003112525.1.64854 WP_003112525.1.64983 WP_003112525.1.65009 WP_003112525.1.65066 WP_003112525.1.65092 WP_003112525.1.65099 WP_003112525.1.65197 WP_003112525.1.65237 WP_003112525.1.65247 WP_003112525.1.65304 WP_003112525.1.65337 WP_003112525.1.65549 WP_003112525.1.65588 WP_003112525.1.65740 WP_003112525.1.65867 WP_003112525.1.6589 WP_003112525.1.66062 WP_003112525.1.66165 WP_003112525.1.6627 WP_003112525.1.6629 WP_003112525.1.66345 WP_003112525.1.66371 WP_003112525.1.66526 WP_003112525.1.66892 WP_003112525.1.67010 WP_003112525.1.67188 WP_003112525.1.6734 WP_003112525.1.67388 WP_003112525.1.67531 WP_003112525.1.67545 WP_003112525.1.6768 WP_003112525.1.67686 WP_003112525.1.67755 WP_003112525.1.67903 WP_003112525.1.67948 WP_003112525.1.6808 WP_003112525.1.68162 WP_003112525.1.68183 WP_003112525.1.68317 WP_003112525.1.68472 WP_003112525.1.68541 WP_003112525.1.68561 WP_003112525.1.68638 WP_003112525.1.68781 WP_003112525.1.68857 WP_003112525.1.68862 WP_003112525.1.68910 WP_003112525.1.6928 WP_003112525.1.6931 WP_003112525.1.6937 WP_003112525.1.69788 WP_003112525.1.69791 WP_003112525.1.70092 WP_003112525.1.70098 WP_003112525.1.70168 WP_003112525.1.70194 WP_003112525.1.70229 WP_003112525.1.70331 WP_003112525.1.70460 WP_003112525.1.70470 WP_003112525.1.70648 WP_003112525.1.70677 WP_003112525.1.70693 WP_003112525.1.70831 WP_003112525.1.71346 WP_003112525.1.71570 WP_003112525.1.71642 WP_003112525.1.71666 WP_003112525.1.71799 WP_003112525.1.71806 WP_003112525.1.71822 WP_003112525.1.71891 WP_003112525.1.71934 WP_003112525.1.72149 WP_003112525.1.72181 WP_003112525.1.72323 WP_003112525.1.72331 WP_003112525.1.72378 WP_003112525.1.72447 WP_003112525.1.72458 WP_003112525.1.72570 WP_003112525.1.72653 WP_003112525.1.72669 WP_003112525.1.72772 WP_003112525.1.7308 WP_003112525.1.73149 WP_003112525.1.73172 WP_003112525.1.7329 WP_003112525.1.733 WP_003112525.1.73455 WP_003112525.1.73490 WP_003112525.1.73523 WP_003112525.1.73541 WP_003112525.1.73728 WP_003112525.1.73791 WP_003112525.1.73860 WP_003112525.1.73889 WP_003112525.1.74000 WP_003112525.1.7408 WP_003112525.1.74106 WP_003112525.1.74167 WP_003112525.1.74180 WP_003112525.1.74182 WP_003112525.1.74264 WP_003112525.1.74268 WP_003112525.1.74475 WP_003112525.1.7456 WP_003112525.1.74604 WP_003112525.1.74772 WP_003112525.1.74948 WP_003112525.1.74958 WP_003112525.1.75041 WP_003112525.1.75119 WP_003112525.1.75204 WP_003112525.1.75277 WP_003112525.1.75303 WP_003112525.1.7547 WP_003112525.1.75599 WP_003112525.1.75631 WP_003112525.1.75792 WP_003112525.1.75860 WP_003112525.1.75935 WP_003112525.1.75938 WP_003112525.1.76092 WP_003112525.1.76145 WP_003112525.1.76383 WP_003112525.1.76441 WP_003112525.1.76484 WP_003112525.1.7666 WP_003112525.1.76922 WP_003112525.1.76985 WP_003112525.1.77238 WP_003112525.1.77476 WP_003112525.1.77490 WP_003112525.1.77574 WP_003112525.1.77587 WP_003112525.1.77686 WP_003112525.1.77750 WP_003112525.1.77769 WP_003112525.1.77819 WP_003112525.1.77913 WP_003112525.1.78112 WP_003112525.1.78134 WP_003112525.1.78380 WP_003112525.1.78409 WP_003112525.1.78430 WP_003112525.1.78623 WP_003112525.1.78669 WP_003112525.1.78795 WP_003112525.1.78810 WP_003112525.1.78926 WP_003112525.1.78954 WP_003112525.1.78986 WP_003112525.1.79193 WP_003112525.1.79256 WP_003112525.1.79357 WP_003112525.1.79429 WP_003112525.1.7945 WP_003112525.1.79463 WP_003112525.1.79507 WP_003112525.1.79699 WP_003112525.1.79908 WP_003112525.1.79986 WP_003112525.1.80068 WP_003112525.1.80087 WP_003112525.1.8028 WP_003112525.1.80306 WP_003112525.1.80411 WP_003112525.1.80481 WP_003112525.1.8051 WP_003112525.1.80535 WP_003112525.1.80572 WP_003112525.1.80627 WP_003112525.1.80632 WP_003112525.1.80644 WP_003112525.1.80645 WP_003112525.1.80720 WP_003112525.1.80880 WP_003112525.1.80929 WP_003112525.1.80938 WP_003112525.1.81081 WP_003112525.1.8110 WP_003112525.1.81206 WP_003112525.1.81237 WP_003112525.1.81482 WP_003112525.1.81487 WP_003112525.1.81742 WP_003112525.1.81748 WP_003112525.1.81771 WP_003112525.1.81784 WP_003112525.1.81802 WP_003112525.1.81816 WP_003112525.1.81834 WP_003112525.1.81957 WP_003112525.1.82117 WP_003112525.1.82127 WP_003112525.1.82178 WP_003112525.1.82260 WP_003112525.1.8227 WP_003112525.1.82328 WP_003112525.1.82442 WP_003112525.1.82487 WP_003112525.1.82580 WP_003112525.1.82604 WP_003112525.1.82620 WP_003112525.1.82643 WP_003112525.1.82710 WP_003112525.1.82882 WP_003112525.1.82887 WP_003112525.1.82936 WP_003112525.1.83025 WP_003112525.1.83131 WP_003112525.1.83213 WP_003112525.1.83463 WP_003112525.1.8353 WP_003112525.1.83534 WP_003112525.1.83637 WP_003112525.1.83673 WP_003112525.1.83698 WP_003112525.1.83946 WP_003112525.1.84003 WP_003112525.1.84162 WP_003112525.1.84177 WP_003112525.1.8437 WP_003112525.1.84374 WP_003112525.1.84398 WP_003112525.1.84404 WP_003112525.1.84471 WP_003112525.1.84589 WP_003112525.1.84715 WP_003112525.1.84754 WP_003112525.1.84792 WP_003112525.1.8484 WP_003112525.1.84937 WP_003112525.1.85059 WP_003112525.1.85220 WP_003112525.1.85290 WP_003112525.1.85298 WP_003112525.1.85357 WP_003112525.1.85446 WP_003112525.1.85633 WP_003112525.1.85788 WP_003112525.1.86002 WP_003112525.1.86055 WP_003112525.1.861 WP_003112525.1.86125 WP_003112525.1.86287 WP_003112525.1.86293 WP_003112525.1.865 WP_003112525.1.86545 WP_003112525.1.86652 WP_003112525.1.867 WP_003112525.1.86774 WP_003112525.1.86780 WP_003112525.1.86785 WP_003112525.1.86813 WP_003112525.1.8693 WP_003112525.1.87183 WP_003112525.1.8727 WP_003112525.1.87435 WP_003112525.1.8749 WP_003112525.1.87547 WP_003112525.1.87648 WP_003112525.1.87763 WP_003112525.1.87970 WP_003112525.1.87987 WP_003112525.1.88330 WP_003112525.1.88360 WP_003112525.1.88517 WP_003112525.1.8852 WP_003112525.1.88605 WP_003112525.1.88659 WP_003112525.1.88680 WP_003112525.1.88750 WP_003112525.1.88969 WP_003112525.1.89083 WP_003112525.1.89098 WP_003112525.1.89276 WP_003112525.1.89330 WP_003112525.1.89409 WP_003112525.1.89434 WP_003112525.1.89523 WP_003112525.1.89638 WP_003112525.1.89669 WP_003112525.1.89867 WP_003112525.1.90032 WP_003112525.1.90056 WP_003112525.1.90110 WP_003112525.1.90141 WP_003112525.1.90150 WP_003112525.1.90189 WP_003112525.1.90224 WP_003112525.1.90225 WP_003112525.1.90268 WP_003112525.1.9056 WP_003112525.1.90655 WP_003112525.1.90770 WP_003112525.1.90999 WP_003112525.1.91161 WP_003112525.1.91204 WP_003112525.1.91307 WP_003112525.1.91336 WP_003112525.1.91416 WP_003112525.1.91431 WP_003112525.1.91438 WP_003112525.1.91803 WP_003112525.1.9182 WP_003112525.1.91838 WP_003112525.1.91846 WP_003112525.1.91862 WP_003112525.1.9191 WP_003112525.1.91943 WP_003112525.1.92043 WP_003112525.1.92175 WP_003112525.1.92314 WP_003112525.1.92357 WP_003112525.1.92454 WP_003112525.1.92585 WP_003112525.1.92589 WP_003112525.1.92624 WP_003112525.1.92642 WP_003112525.1.92769 WP_003112525.1.92839 WP_003112525.1.92847 WP_003112525.1.92924 WP_003112525.1.92930 WP_003112525.1.93001 WP_003112525.1.93090 WP_003112525.1.93122 WP_003112525.1.93130 WP_003112525.1.93144 WP_003112525.1.93148 WP_003112525.1.9349 WP_003112525.1.93493 WP_003112525.1.93498 WP_003112525.1.93547 WP_003112525.1.93562 WP_003112525.1.94136 WP_003112525.1.94211 WP_003112525.1.9444 WP_003112525.1.94814 WP_003112525.1.94856 WP_003112525.1.94874 WP_003112525.1.94897 WP_003112525.1.95018 WP_003112525.1.95025 WP_003112525.1.95207 WP_003112525.1.95217 WP_003112525.1.95359 WP_003112525.1.95460 WP_003112525.1.95536 WP_003112525.1.95638 WP_003112525.1.95668 WP_003112525.1.95745 WP_003112525.1.95751 WP_003112525.1.95787 WP_003112525.1.95994 WP_003112525.1.96134 WP_003112525.1.96193 WP_003112525.1.96384 WP_003112525.1.96452 WP_003112525.1.96506 WP_003112525.1.96714 WP_003112525.1.96967 WP_003112525.1.9706 WP_003112525.1.97126 WP_003112525.1.9722 WP_003112525.1.977 WP_003112525.1.97826 WP_003112525.1.98276 WP_003112525.1.98433 WP_003112525.1.98515 WP_003112525.1.98573 WP_003112525.1.98600 WP_003112525.1.98672 WP_003112525.1.98678 WP_003112525.1.98718 WP_003112525.1.98788 WP_003112525.1.9885 WP_003112525.1.98907 WP_003112525.1.98958 WP_003112525.1.98960 WP_003112525.1.99068 WP_003112525.1.99103 WP_003112525.1.99293 WP_003112525.1.99386 WP_003112525.1.99389 WP_003112525.1.99461 WP_003112525.1.99516 WP_003112525.1.99654 WP_003112525.1.99662 WP_003112525.1.99746 WP_003112525.1.99757 WP_003112525.1.99835 WP_003112525.1.9989 WP_003112525.1.99930 gi|218893005|ref|YP_002441874.1| gi|386060073|ref|YP_005976595.1| gi|514408553|ref|YP_008131574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]