SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155773|ref|YP_008944764.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155773|ref|YP_008944764.1|
Domain Number 1 Region: 71-84,148-239
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000000719
Family TolA 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568155773|ref|YP_008944764.1|
Sequence length 248
Comment energy transduction protein TonB [Pseudomonas aeruginosa LES431]
Sequence
MNMSADPKHTPEPKNAAPLSIDGRPANPTLRYLKWGLGALLLAGLAWLVWEWANDMSGVR
REAPKVPAIIPLPPPPPPPPEKPPEPEQPVEEEKIVEPEPQPELEEVKPQEEAPPSPADD
LADPMQMDGDAQSGSDAFNIGAGKGGGMAGSGGGRAGNASYSQYLAYAFQRLLRDNPELR
NLAFRLQAEIWLSSSGDITRAELTRSSGDPETDQKVLAALRAAGRLEERPPASLTLPVRI
ALQGKRPG
Download sequence
Identical sequences A0A0E1B3K1 A0A0H3QX73 A0A211V214 Q9I5N1 W1MM74
gi|568155773|ref|YP_008944764.1| NP_249386.1.87394 WP_003098450.1.100071 WP_003098450.1.100179 WP_003098450.1.100394 WP_003098450.1.100420 WP_003098450.1.100473 WP_003098450.1.100476 WP_003098450.1.100523 WP_003098450.1.100723 WP_003098450.1.100742 WP_003098450.1.100777 WP_003098450.1.100809 WP_003098450.1.100810 WP_003098450.1.101021 WP_003098450.1.101090 WP_003098450.1.101269 WP_003098450.1.101642 WP_003098450.1.101712 WP_003098450.1.10179 WP_003098450.1.10185 WP_003098450.1.101871 WP_003098450.1.10201 WP_003098450.1.102045 WP_003098450.1.10257 WP_003098450.1.10407 WP_003098450.1.10435 WP_003098450.1.10457 WP_003098450.1.10482 WP_003098450.1.10529 WP_003098450.1.10572 WP_003098450.1.10641 WP_003098450.1.10684 WP_003098450.1.10764 WP_003098450.1.10856 WP_003098450.1.10949 WP_003098450.1.11026 WP_003098450.1.11058 WP_003098450.1.11077 WP_003098450.1.11388 WP_003098450.1.11410 WP_003098450.1.11653 WP_003098450.1.11744 WP_003098450.1.11754 WP_003098450.1.1180 WP_003098450.1.11847 WP_003098450.1.1187 WP_003098450.1.11943 WP_003098450.1.12120 WP_003098450.1.12302 WP_003098450.1.1238 WP_003098450.1.12482 WP_003098450.1.12530 WP_003098450.1.12547 WP_003098450.1.12561 WP_003098450.1.12657 WP_003098450.1.12670 WP_003098450.1.12687 WP_003098450.1.12873 WP_003098450.1.12970 WP_003098450.1.12980 WP_003098450.1.13 WP_003098450.1.1305 WP_003098450.1.13092 WP_003098450.1.13232 WP_003098450.1.13242 WP_003098450.1.13270 WP_003098450.1.13529 WP_003098450.1.13533 WP_003098450.1.1356 WP_003098450.1.1362 WP_003098450.1.13622 WP_003098450.1.13765 WP_003098450.1.13865 WP_003098450.1.14049 WP_003098450.1.14096 WP_003098450.1.14204 WP_003098450.1.14378 WP_003098450.1.14424 WP_003098450.1.14463 WP_003098450.1.14525 WP_003098450.1.14615 WP_003098450.1.14714 WP_003098450.1.1475 WP_003098450.1.14754 WP_003098450.1.14815 WP_003098450.1.14820 WP_003098450.1.14966 WP_003098450.1.15130 WP_003098450.1.1516 WP_003098450.1.152 WP_003098450.1.15231 WP_003098450.1.15281 WP_003098450.1.15297 WP_003098450.1.15379 WP_003098450.1.15474 WP_003098450.1.15482 WP_003098450.1.15485 WP_003098450.1.15602 WP_003098450.1.15692 WP_003098450.1.15886 WP_003098450.1.16041 WP_003098450.1.16074 WP_003098450.1.16109 WP_003098450.1.16142 WP_003098450.1.16197 WP_003098450.1.16239 WP_003098450.1.16242 WP_003098450.1.16279 WP_003098450.1.1646 WP_003098450.1.16660 WP_003098450.1.1670 WP_003098450.1.1671 WP_003098450.1.16895 WP_003098450.1.1704 WP_003098450.1.17155 WP_003098450.1.17354 WP_003098450.1.17370 WP_003098450.1.17397 WP_003098450.1.17566 WP_003098450.1.1761 WP_003098450.1.17883 WP_003098450.1.18052 WP_003098450.1.1824 WP_003098450.1.18349 WP_003098450.1.18653 WP_003098450.1.18735 WP_003098450.1.18795 WP_003098450.1.18852 WP_003098450.1.18911 WP_003098450.1.190 WP_003098450.1.19251 WP_003098450.1.19260 WP_003098450.1.19346 WP_003098450.1.1938 WP_003098450.1.19552 WP_003098450.1.19591 WP_003098450.1.19703 WP_003098450.1.19718 WP_003098450.1.19771 WP_003098450.1.19824 WP_003098450.1.19931 WP_003098450.1.20134 WP_003098450.1.20216 WP_003098450.1.20682 WP_003098450.1.20692 WP_003098450.1.20744 WP_003098450.1.20764 WP_003098450.1.20854 WP_003098450.1.20884 WP_003098450.1.209 WP_003098450.1.20929 WP_003098450.1.21039 WP_003098450.1.21096 WP_003098450.1.21100 WP_003098450.1.21166 WP_003098450.1.21242 WP_003098450.1.21253 WP_003098450.1.21302 WP_003098450.1.21349 WP_003098450.1.21358 WP_003098450.1.2144 WP_003098450.1.21448 WP_003098450.1.21460 WP_003098450.1.21471 WP_003098450.1.21517 WP_003098450.1.21607 WP_003098450.1.21718 WP_003098450.1.2172 WP_003098450.1.21744 WP_003098450.1.21767 WP_003098450.1.21782 WP_003098450.1.21801 WP_003098450.1.21871 WP_003098450.1.21891 WP_003098450.1.21932 WP_003098450.1.22078 WP_003098450.1.221 WP_003098450.1.2228 WP_003098450.1.22390 WP_003098450.1.22394 WP_003098450.1.22477 WP_003098450.1.22491 WP_003098450.1.22573 WP_003098450.1.22671 WP_003098450.1.22729 WP_003098450.1.22863 WP_003098450.1.2289 WP_003098450.1.22891 WP_003098450.1.23013 WP_003098450.1.23195 WP_003098450.1.2323 WP_003098450.1.23264 WP_003098450.1.23331 WP_003098450.1.23418 WP_003098450.1.23512 WP_003098450.1.23523 WP_003098450.1.2355 WP_003098450.1.23559 WP_003098450.1.23581 WP_003098450.1.236 WP_003098450.1.23641 WP_003098450.1.23715 WP_003098450.1.23739 WP_003098450.1.23769 WP_003098450.1.23884 WP_003098450.1.23925 WP_003098450.1.23938 WP_003098450.1.23961 WP_003098450.1.24066 WP_003098450.1.24077 WP_003098450.1.24087 WP_003098450.1.24101 WP_003098450.1.24234 WP_003098450.1.24319 WP_003098450.1.24351 WP_003098450.1.2453 WP_003098450.1.24662 WP_003098450.1.2477 WP_003098450.1.24879 WP_003098450.1.24938 WP_003098450.1.25033 WP_003098450.1.25075 WP_003098450.1.251 WP_003098450.1.25142 WP_003098450.1.25149 WP_003098450.1.25179 WP_003098450.1.25191 WP_003098450.1.2529 WP_003098450.1.25328 WP_003098450.1.25344 WP_003098450.1.25348 WP_003098450.1.25477 WP_003098450.1.25532 WP_003098450.1.25600 WP_003098450.1.25695 WP_003098450.1.2572 WP_003098450.1.25903 WP_003098450.1.26042 WP_003098450.1.261 WP_003098450.1.26301 WP_003098450.1.26428 WP_003098450.1.26473 WP_003098450.1.26489 WP_003098450.1.26539 WP_003098450.1.26553 WP_003098450.1.26816 WP_003098450.1.26841 WP_003098450.1.26906 WP_003098450.1.2698 WP_003098450.1.27018 WP_003098450.1.27107 WP_003098450.1.27211 WP_003098450.1.27259 WP_003098450.1.27505 WP_003098450.1.27534 WP_003098450.1.27587 WP_003098450.1.27738 WP_003098450.1.27783 WP_003098450.1.27837 WP_003098450.1.27933 WP_003098450.1.27939 WP_003098450.1.28006 WP_003098450.1.28057 WP_003098450.1.28078 WP_003098450.1.28136 WP_003098450.1.28258 WP_003098450.1.283 WP_003098450.1.28372 WP_003098450.1.28468 WP_003098450.1.28528 WP_003098450.1.28602 WP_003098450.1.28699 WP_003098450.1.28800 WP_003098450.1.28838 WP_003098450.1.28849 WP_003098450.1.29062 WP_003098450.1.29096 WP_003098450.1.29127 WP_003098450.1.29137 WP_003098450.1.29208 WP_003098450.1.29401 WP_003098450.1.2941 WP_003098450.1.29472 WP_003098450.1.29481 WP_003098450.1.29498 WP_003098450.1.2961 WP_003098450.1.29668 WP_003098450.1.29753 WP_003098450.1.29848 WP_003098450.1.29958 WP_003098450.1.30000 WP_003098450.1.30120 WP_003098450.1.30475 WP_003098450.1.30567 WP_003098450.1.30614 WP_003098450.1.30625 WP_003098450.1.30707 WP_003098450.1.30740 WP_003098450.1.30797 WP_003098450.1.30815 WP_003098450.1.30886 WP_003098450.1.30943 WP_003098450.1.31076 WP_003098450.1.31087 WP_003098450.1.31105 WP_003098450.1.31138 WP_003098450.1.31147 WP_003098450.1.31279 WP_003098450.1.31565 WP_003098450.1.31587 WP_003098450.1.3172 WP_003098450.1.31741 WP_003098450.1.3179 WP_003098450.1.31848 WP_003098450.1.31852 WP_003098450.1.3189 WP_003098450.1.31939 WP_003098450.1.32314 WP_003098450.1.32523 WP_003098450.1.32544 WP_003098450.1.32711 WP_003098450.1.32821 WP_003098450.1.33133 WP_003098450.1.33152 WP_003098450.1.33210 WP_003098450.1.33216 WP_003098450.1.33340 WP_003098450.1.33387 WP_003098450.1.33521 WP_003098450.1.33523 WP_003098450.1.33547 WP_003098450.1.33549 WP_003098450.1.33658 WP_003098450.1.33669 WP_003098450.1.33733 WP_003098450.1.33734 WP_003098450.1.33801 WP_003098450.1.33822 WP_003098450.1.34000 WP_003098450.1.34136 WP_003098450.1.34191 WP_003098450.1.34306 WP_003098450.1.34317 WP_003098450.1.34324 WP_003098450.1.34402 WP_003098450.1.34461 WP_003098450.1.34472 WP_003098450.1.3452 WP_003098450.1.34568 WP_003098450.1.34625 WP_003098450.1.34784 WP_003098450.1.34821 WP_003098450.1.34832 WP_003098450.1.34837 WP_003098450.1.34878 WP_003098450.1.34922 WP_003098450.1.34942 WP_003098450.1.35036 WP_003098450.1.35149 WP_003098450.1.35231 WP_003098450.1.3531 WP_003098450.1.35325 WP_003098450.1.35353 WP_003098450.1.3540 WP_003098450.1.35431 WP_003098450.1.35480 WP_003098450.1.35512 WP_003098450.1.35573 WP_003098450.1.35639 WP_003098450.1.35641 WP_003098450.1.35669 WP_003098450.1.35679 WP_003098450.1.3568 WP_003098450.1.35682 WP_003098450.1.3576 WP_003098450.1.35762 WP_003098450.1.35768 WP_003098450.1.35857 WP_003098450.1.35872 WP_003098450.1.35984 WP_003098450.1.36170 WP_003098450.1.36435 WP_003098450.1.36487 WP_003098450.1.36521 WP_003098450.1.36587 WP_003098450.1.36608 WP_003098450.1.3662 WP_003098450.1.36665 WP_003098450.1.36708 WP_003098450.1.3672 WP_003098450.1.36756 WP_003098450.1.36781 WP_003098450.1.36879 WP_003098450.1.37097 WP_003098450.1.37125 WP_003098450.1.37163 WP_003098450.1.37208 WP_003098450.1.3721 WP_003098450.1.37500 WP_003098450.1.37703 WP_003098450.1.3781 WP_003098450.1.37814 WP_003098450.1.37818 WP_003098450.1.37842 WP_003098450.1.3785 WP_003098450.1.3792 WP_003098450.1.38003 WP_003098450.1.38146 WP_003098450.1.38151 WP_003098450.1.3821 WP_003098450.1.3833 WP_003098450.1.38337 WP_003098450.1.38406 WP_003098450.1.38430 WP_003098450.1.38502 WP_003098450.1.38505 WP_003098450.1.38582 WP_003098450.1.38583 WP_003098450.1.38587 WP_003098450.1.38661 WP_003098450.1.3870 WP_003098450.1.38727 WP_003098450.1.38834 WP_003098450.1.38889 WP_003098450.1.38971 WP_003098450.1.39046 WP_003098450.1.39088 WP_003098450.1.39186 WP_003098450.1.39271 WP_003098450.1.3943 WP_003098450.1.39444 WP_003098450.1.39452 WP_003098450.1.39458 WP_003098450.1.39786 WP_003098450.1.3998 WP_003098450.1.39989 WP_003098450.1.40059 WP_003098450.1.40115 WP_003098450.1.40135 WP_003098450.1.40207 WP_003098450.1.40243 WP_003098450.1.40419 WP_003098450.1.40512 WP_003098450.1.40513 WP_003098450.1.40541 WP_003098450.1.40546 WP_003098450.1.40703 WP_003098450.1.40950 WP_003098450.1.41290 WP_003098450.1.41291 WP_003098450.1.41301 WP_003098450.1.41492 WP_003098450.1.41502 WP_003098450.1.4156 WP_003098450.1.41618 WP_003098450.1.41624 WP_003098450.1.41625 WP_003098450.1.41703 WP_003098450.1.41732 WP_003098450.1.41773 WP_003098450.1.41832 WP_003098450.1.41846 WP_003098450.1.41871 WP_003098450.1.41888 WP_003098450.1.4190 WP_003098450.1.41939 WP_003098450.1.4196 WP_003098450.1.42 WP_003098450.1.42041 WP_003098450.1.42146 WP_003098450.1.42294 WP_003098450.1.42381 WP_003098450.1.42411 WP_003098450.1.42423 WP_003098450.1.42463 WP_003098450.1.42508 WP_003098450.1.42696 WP_003098450.1.42757 WP_003098450.1.42854 WP_003098450.1.42917 WP_003098450.1.43024 WP_003098450.1.43245 WP_003098450.1.43293 WP_003098450.1.43356 WP_003098450.1.43593 WP_003098450.1.43662 WP_003098450.1.43673 WP_003098450.1.43696 WP_003098450.1.43729 WP_003098450.1.43783 WP_003098450.1.43802 WP_003098450.1.4381 WP_003098450.1.43811 WP_003098450.1.43826 WP_003098450.1.44213 WP_003098450.1.44260 WP_003098450.1.44563 WP_003098450.1.44581 WP_003098450.1.44739 WP_003098450.1.44760 WP_003098450.1.45090 WP_003098450.1.45146 WP_003098450.1.45306 WP_003098450.1.45312 WP_003098450.1.45353 WP_003098450.1.45358 WP_003098450.1.45464 WP_003098450.1.45485 WP_003098450.1.45635 WP_003098450.1.45636 WP_003098450.1.45678 WP_003098450.1.45723 WP_003098450.1.45818 WP_003098450.1.45837 WP_003098450.1.45934 WP_003098450.1.45961 WP_003098450.1.46093 WP_003098450.1.461 WP_003098450.1.46152 WP_003098450.1.46200 WP_003098450.1.46436 WP_003098450.1.46623 WP_003098450.1.46633 WP_003098450.1.46755 WP_003098450.1.46787 WP_003098450.1.46846 WP_003098450.1.46866 WP_003098450.1.46926 WP_003098450.1.47101 WP_003098450.1.47150 WP_003098450.1.47158 WP_003098450.1.47251 WP_003098450.1.47296 WP_003098450.1.47312 WP_003098450.1.47469 WP_003098450.1.47598 WP_003098450.1.47774 WP_003098450.1.47930 WP_003098450.1.47934 WP_003098450.1.47970 WP_003098450.1.48001 WP_003098450.1.48086 WP_003098450.1.48141 WP_003098450.1.48321 WP_003098450.1.48378 WP_003098450.1.48382 WP_003098450.1.48413 WP_003098450.1.48487 WP_003098450.1.48747 WP_003098450.1.48820 WP_003098450.1.48842 WP_003098450.1.48870 WP_003098450.1.48961 WP_003098450.1.49135 WP_003098450.1.49244 WP_003098450.1.49265 WP_003098450.1.49266 WP_003098450.1.49277 WP_003098450.1.49286 WP_003098450.1.49293 WP_003098450.1.49360 WP_003098450.1.49500 WP_003098450.1.49566 WP_003098450.1.49688 WP_003098450.1.49798 WP_003098450.1.49833 WP_003098450.1.49842 WP_003098450.1.49988 WP_003098450.1.49998 WP_003098450.1.50176 WP_003098450.1.50180 WP_003098450.1.50222 WP_003098450.1.5043 WP_003098450.1.50459 WP_003098450.1.50653 WP_003098450.1.50665 WP_003098450.1.50668 WP_003098450.1.50783 WP_003098450.1.50922 WP_003098450.1.50967 WP_003098450.1.51019 WP_003098450.1.51141 WP_003098450.1.51173 WP_003098450.1.51457 WP_003098450.1.51549 WP_003098450.1.51807 WP_003098450.1.51889 WP_003098450.1.51928 WP_003098450.1.51937 WP_003098450.1.51943 WP_003098450.1.52152 WP_003098450.1.52212 WP_003098450.1.52220 WP_003098450.1.5226 WP_003098450.1.52326 WP_003098450.1.52334 WP_003098450.1.5235 WP_003098450.1.52355 WP_003098450.1.52449 WP_003098450.1.52537 WP_003098450.1.5258 WP_003098450.1.52583 WP_003098450.1.5260 WP_003098450.1.52690 WP_003098450.1.52700 WP_003098450.1.52784 WP_003098450.1.52790 WP_003098450.1.52810 WP_003098450.1.5294 WP_003098450.1.53038 WP_003098450.1.53169 WP_003098450.1.53287 WP_003098450.1.53351 WP_003098450.1.53414 WP_003098450.1.53427 WP_003098450.1.53528 WP_003098450.1.53530 WP_003098450.1.53663 WP_003098450.1.53826 WP_003098450.1.53932 WP_003098450.1.53951 WP_003098450.1.54003 WP_003098450.1.54133 WP_003098450.1.54140 WP_003098450.1.54146 WP_003098450.1.54248 WP_003098450.1.54354 WP_003098450.1.54462 WP_003098450.1.54809 WP_003098450.1.54974 WP_003098450.1.55089 WP_003098450.1.55169 WP_003098450.1.55318 WP_003098450.1.55347 WP_003098450.1.55400 WP_003098450.1.55478 WP_003098450.1.56145 WP_003098450.1.56171 WP_003098450.1.56187 WP_003098450.1.56188 WP_003098450.1.56196 WP_003098450.1.56229 WP_003098450.1.56315 WP_003098450.1.56348 WP_003098450.1.56442 WP_003098450.1.56623 WP_003098450.1.56632 WP_003098450.1.56768 WP_003098450.1.56797 WP_003098450.1.56808 WP_003098450.1.56819 WP_003098450.1.56837 WP_003098450.1.56864 WP_003098450.1.56973 WP_003098450.1.57113 WP_003098450.1.57131 WP_003098450.1.57140 WP_003098450.1.57276 WP_003098450.1.57339 WP_003098450.1.57417 WP_003098450.1.57460 WP_003098450.1.57480 WP_003098450.1.57548 WP_003098450.1.57839 WP_003098450.1.57853 WP_003098450.1.58056 WP_003098450.1.58155 WP_003098450.1.58162 WP_003098450.1.58183 WP_003098450.1.58193 WP_003098450.1.58294 WP_003098450.1.5856 WP_003098450.1.58785 WP_003098450.1.5889 WP_003098450.1.59013 WP_003098450.1.59076 WP_003098450.1.59099 WP_003098450.1.59246 WP_003098450.1.5937 WP_003098450.1.59376 WP_003098450.1.594 WP_003098450.1.59469 WP_003098450.1.59724 WP_003098450.1.59797 WP_003098450.1.59831 WP_003098450.1.59870 WP_003098450.1.60079 WP_003098450.1.60082 WP_003098450.1.60261 WP_003098450.1.60364 WP_003098450.1.60415 WP_003098450.1.60467 WP_003098450.1.60602 WP_003098450.1.60603 WP_003098450.1.60639 WP_003098450.1.60679 WP_003098450.1.60686 WP_003098450.1.607 WP_003098450.1.60910 WP_003098450.1.60916 WP_003098450.1.61130 WP_003098450.1.61191 WP_003098450.1.61209 WP_003098450.1.61222 WP_003098450.1.61269 WP_003098450.1.61288 WP_003098450.1.61299 WP_003098450.1.6130 WP_003098450.1.61366 WP_003098450.1.61431 WP_003098450.1.61549 WP_003098450.1.61589 WP_003098450.1.61598 WP_003098450.1.61696 WP_003098450.1.61943 WP_003098450.1.62035 WP_003098450.1.62186 WP_003098450.1.62211 WP_003098450.1.62357 WP_003098450.1.62396 WP_003098450.1.62483 WP_003098450.1.62516 WP_003098450.1.62534 WP_003098450.1.626 WP_003098450.1.62635 WP_003098450.1.62701 WP_003098450.1.62708 WP_003098450.1.62716 WP_003098450.1.62768 WP_003098450.1.62772 WP_003098450.1.6280 WP_003098450.1.62873 WP_003098450.1.62917 WP_003098450.1.62977 WP_003098450.1.63124 WP_003098450.1.63196 WP_003098450.1.63338 WP_003098450.1.63369 WP_003098450.1.63597 WP_003098450.1.63659 WP_003098450.1.64155 WP_003098450.1.64212 WP_003098450.1.64340 WP_003098450.1.6450 WP_003098450.1.64603 WP_003098450.1.64748 WP_003098450.1.64807 WP_003098450.1.64862 WP_003098450.1.64885 WP_003098450.1.64983 WP_003098450.1.64984 WP_003098450.1.65066 WP_003098450.1.65099 WP_003098450.1.65145 WP_003098450.1.65197 WP_003098450.1.65227 WP_003098450.1.65247 WP_003098450.1.65285 WP_003098450.1.65304 WP_003098450.1.65334 WP_003098450.1.65549 WP_003098450.1.65588 WP_003098450.1.65642 WP_003098450.1.65740 WP_003098450.1.65779 WP_003098450.1.65819 WP_003098450.1.65867 WP_003098450.1.6589 WP_003098450.1.65926 WP_003098450.1.66062 WP_003098450.1.66165 WP_003098450.1.6627 WP_003098450.1.66277 WP_003098450.1.66345 WP_003098450.1.66348 WP_003098450.1.66364 WP_003098450.1.66526 WP_003098450.1.66634 WP_003098450.1.66892 WP_003098450.1.66929 WP_003098450.1.66931 WP_003098450.1.66945 WP_003098450.1.66950 WP_003098450.1.67010 WP_003098450.1.67205 WP_003098450.1.67261 WP_003098450.1.67269 WP_003098450.1.6734 WP_003098450.1.67370 WP_003098450.1.67388 WP_003098450.1.67472 WP_003098450.1.67526 WP_003098450.1.67531 WP_003098450.1.67545 WP_003098450.1.67686 WP_003098450.1.67830 WP_003098450.1.67899 WP_003098450.1.67948 WP_003098450.1.6808 WP_003098450.1.68158 WP_003098450.1.68252 WP_003098450.1.68317 WP_003098450.1.68561 WP_003098450.1.68638 WP_003098450.1.68756 WP_003098450.1.68850 WP_003098450.1.68857 WP_003098450.1.68862 WP_003098450.1.68910 WP_003098450.1.68938 WP_003098450.1.6911 WP_003098450.1.69159 WP_003098450.1.69260 WP_003098450.1.6931 WP_003098450.1.6937 WP_003098450.1.69411 WP_003098450.1.69534 WP_003098450.1.69556 WP_003098450.1.69599 WP_003098450.1.69702 WP_003098450.1.69791 WP_003098450.1.69819 WP_003098450.1.69834 WP_003098450.1.69907 WP_003098450.1.69993 WP_003098450.1.70098 WP_003098450.1.70138 WP_003098450.1.70561 WP_003098450.1.70648 WP_003098450.1.70693 WP_003098450.1.7077 WP_003098450.1.70778 WP_003098450.1.70831 WP_003098450.1.70991 WP_003098450.1.71038 WP_003098450.1.71203 WP_003098450.1.71254 WP_003098450.1.7128 WP_003098450.1.71642 WP_003098450.1.71799 WP_003098450.1.71806 WP_003098450.1.72167 WP_003098450.1.72287 WP_003098450.1.72331 WP_003098450.1.72378 WP_003098450.1.72447 WP_003098450.1.72458 WP_003098450.1.72541 WP_003098450.1.72562 WP_003098450.1.72570 WP_003098450.1.72669 WP_003098450.1.72727 WP_003098450.1.72768 WP_003098450.1.72845 WP_003098450.1.73048 WP_003098450.1.73135 WP_003098450.1.73149 WP_003098450.1.73172 WP_003098450.1.7327 WP_003098450.1.7329 WP_003098450.1.73455 WP_003098450.1.73541 WP_003098450.1.73719 WP_003098450.1.7382 WP_003098450.1.73860 WP_003098450.1.73889 WP_003098450.1.73911 WP_003098450.1.73941 WP_003098450.1.74 WP_003098450.1.74072 WP_003098450.1.7408 WP_003098450.1.74175 WP_003098450.1.74219 WP_003098450.1.74264 WP_003098450.1.74268 WP_003098450.1.74287 WP_003098450.1.74458 WP_003098450.1.74473 WP_003098450.1.74518 WP_003098450.1.7456 WP_003098450.1.74568 WP_003098450.1.74604 WP_003098450.1.74629 WP_003098450.1.74772 WP_003098450.1.748 WP_003098450.1.74878 WP_003098450.1.7547 WP_003098450.1.75573 WP_003098450.1.75792 WP_003098450.1.75860 WP_003098450.1.75935 WP_003098450.1.7595 WP_003098450.1.76092 WP_003098450.1.76145 WP_003098450.1.76322 WP_003098450.1.76355 WP_003098450.1.76383 WP_003098450.1.76399 WP_003098450.1.76441 WP_003098450.1.76600 WP_003098450.1.76716 WP_003098450.1.76791 WP_003098450.1.76861 WP_003098450.1.76922 WP_003098450.1.76985 WP_003098450.1.77235 WP_003098450.1.77286 WP_003098450.1.77317 WP_003098450.1.77686 WP_003098450.1.77769 WP_003098450.1.7779 WP_003098450.1.77913 WP_003098450.1.78134 WP_003098450.1.78148 WP_003098450.1.78158 WP_003098450.1.78280 WP_003098450.1.78425 WP_003098450.1.78430 WP_003098450.1.78437 WP_003098450.1.78570 WP_003098450.1.78669 WP_003098450.1.78795 WP_003098450.1.78810 WP_003098450.1.78926 WP_003098450.1.7899 WP_003098450.1.79007 WP_003098450.1.79193 WP_003098450.1.79256 WP_003098450.1.79311 WP_003098450.1.79357 WP_003098450.1.79364 WP_003098450.1.79421 WP_003098450.1.79431 WP_003098450.1.79463 WP_003098450.1.7953 WP_003098450.1.79569 WP_003098450.1.79631 WP_003098450.1.79788 WP_003098450.1.79862 WP_003098450.1.79902 WP_003098450.1.79908 WP_003098450.1.8028 WP_003098450.1.80410 WP_003098450.1.80454 WP_003098450.1.80481 WP_003098450.1.8051 WP_003098450.1.8064 WP_003098450.1.80644 WP_003098450.1.80645 WP_003098450.1.80846 WP_003098450.1.80880 WP_003098450.1.80892 WP_003098450.1.80910 WP_003098450.1.80929 WP_003098450.1.80969 WP_003098450.1.81082 WP_003098450.1.8110 WP_003098450.1.81487 WP_003098450.1.81581 WP_003098450.1.81591 WP_003098450.1.81728 WP_003098450.1.81748 WP_003098450.1.81784 WP_003098450.1.81834 WP_003098450.1.81844 WP_003098450.1.81950 WP_003098450.1.81957 WP_003098450.1.81960 WP_003098450.1.81986 WP_003098450.1.82178 WP_003098450.1.8227 WP_003098450.1.82328 WP_003098450.1.8238 WP_003098450.1.82442 WP_003098450.1.82487 WP_003098450.1.82580 WP_003098450.1.82604 WP_003098450.1.82606 WP_003098450.1.82620 WP_003098450.1.82686 WP_003098450.1.82710 WP_003098450.1.82882 WP_003098450.1.82887 WP_003098450.1.83025 WP_003098450.1.83184 WP_003098450.1.83251 WP_003098450.1.83267 WP_003098450.1.83296 WP_003098450.1.83317 WP_003098450.1.83374 WP_003098450.1.83394 WP_003098450.1.83463 WP_003098450.1.835 WP_003098450.1.8353 WP_003098450.1.83534 WP_003098450.1.83698 WP_003098450.1.84003 WP_003098450.1.84008 WP_003098450.1.84138 WP_003098450.1.84162 WP_003098450.1.84178 WP_003098450.1.84190 WP_003098450.1.84203 WP_003098450.1.84297 WP_003098450.1.84374 WP_003098450.1.84439 WP_003098450.1.8453 WP_003098450.1.84538 WP_003098450.1.84589 WP_003098450.1.84674 WP_003098450.1.84684 WP_003098450.1.84715 WP_003098450.1.84754 WP_003098450.1.84792 WP_003098450.1.8484 WP_003098450.1.84865 WP_003098450.1.84937 WP_003098450.1.85018 WP_003098450.1.85028 WP_003098450.1.85059 WP_003098450.1.85298 WP_003098450.1.85318 WP_003098450.1.85357 WP_003098450.1.85446 WP_003098450.1.85633 WP_003098450.1.85788 WP_003098450.1.85897 WP_003098450.1.85910 WP_003098450.1.86047 WP_003098450.1.86055 WP_003098450.1.86182 WP_003098450.1.86278 WP_003098450.1.86293 WP_003098450.1.86386 WP_003098450.1.865 WP_003098450.1.86545 WP_003098450.1.86552 WP_003098450.1.86554 WP_003098450.1.86652 WP_003098450.1.867 WP_003098450.1.86708 WP_003098450.1.86733 WP_003098450.1.86774 WP_003098450.1.86780 WP_003098450.1.86785 WP_003098450.1.86822 WP_003098450.1.86947 WP_003098450.1.86985 WP_003098450.1.87104 WP_003098450.1.8718 WP_003098450.1.87182 WP_003098450.1.87183 WP_003098450.1.8727 WP_003098450.1.87390 WP_003098450.1.87435 WP_003098450.1.8749 WP_003098450.1.87530 WP_003098450.1.87547 WP_003098450.1.8777 WP_003098450.1.87970 WP_003098450.1.88330 WP_003098450.1.88360 WP_003098450.1.8852 WP_003098450.1.88578 WP_003098450.1.88659 WP_003098450.1.88679 WP_003098450.1.88714 WP_003098450.1.88750 WP_003098450.1.889 WP_003098450.1.88949 WP_003098450.1.88969 WP_003098450.1.89083 WP_003098450.1.89098 WP_003098450.1.89234 WP_003098450.1.89266 WP_003098450.1.89330 WP_003098450.1.89434 WP_003098450.1.8949 WP_003098450.1.89491 WP_003098450.1.89577 WP_003098450.1.89662 WP_003098450.1.89669 WP_003098450.1.89736 WP_003098450.1.89776 WP_003098450.1.89805 WP_003098450.1.89866 WP_003098450.1.89992 WP_003098450.1.90024 WP_003098450.1.90110 WP_003098450.1.90141 WP_003098450.1.90224 WP_003098450.1.90242 WP_003098450.1.90268 WP_003098450.1.90306 WP_003098450.1.90412 WP_003098450.1.90569 WP_003098450.1.90770 WP_003098450.1.90940 WP_003098450.1.90999 WP_003098450.1.9120 WP_003098450.1.91204 WP_003098450.1.91281 WP_003098450.1.91336 WP_003098450.1.91416 WP_003098450.1.9143 WP_003098450.1.91431 WP_003098450.1.91467 WP_003098450.1.91563 WP_003098450.1.9182 WP_003098450.1.91838 WP_003098450.1.91846 WP_003098450.1.91860 WP_003098450.1.91862 WP_003098450.1.9191 WP_003098450.1.92175 WP_003098450.1.92321 WP_003098450.1.92357 WP_003098450.1.92573 WP_003098450.1.92587 WP_003098450.1.92589 WP_003098450.1.92594 WP_003098450.1.92624 WP_003098450.1.92642 WP_003098450.1.9272 WP_003098450.1.92759 WP_003098450.1.92769 WP_003098450.1.92839 WP_003098450.1.92894 WP_003098450.1.92924 WP_003098450.1.93001 WP_003098450.1.93122 WP_003098450.1.93144 WP_003098450.1.93148 WP_003098450.1.93250 WP_003098450.1.9328 WP_003098450.1.9349 WP_003098450.1.93493 WP_003098450.1.93547 WP_003098450.1.93848 WP_003098450.1.93897 WP_003098450.1.94004 WP_003098450.1.94065 WP_003098450.1.94136 WP_003098450.1.94174 WP_003098450.1.94211 WP_003098450.1.94218 WP_003098450.1.94243 WP_003098450.1.94285 WP_003098450.1.9444 WP_003098450.1.94682 WP_003098450.1.94732 WP_003098450.1.94814 WP_003098450.1.94896 WP_003098450.1.95025 WP_003098450.1.95027 WP_003098450.1.95056 WP_003098450.1.95117 WP_003098450.1.95187 WP_003098450.1.95207 WP_003098450.1.95217 WP_003098450.1.95305 WP_003098450.1.95324 WP_003098450.1.95354 WP_003098450.1.95359 WP_003098450.1.95460 WP_003098450.1.95525 WP_003098450.1.95638 WP_003098450.1.95774 WP_003098450.1.95820 WP_003098450.1.95825 WP_003098450.1.9599 WP_003098450.1.96193 WP_003098450.1.96243 WP_003098450.1.96267 WP_003098450.1.96357 WP_003098450.1.96384 WP_003098450.1.96452 WP_003098450.1.96506 WP_003098450.1.96667 WP_003098450.1.96702 WP_003098450.1.96714 WP_003098450.1.96880 WP_003098450.1.97118 WP_003098450.1.97126 WP_003098450.1.97204 WP_003098450.1.97213 WP_003098450.1.9722 WP_003098450.1.97272 WP_003098450.1.97474 WP_003098450.1.97499 WP_003098450.1.97521 WP_003098450.1.97614 WP_003098450.1.977 WP_003098450.1.97826 WP_003098450.1.97877 WP_003098450.1.97968 WP_003098450.1.98276 WP_003098450.1.98308 WP_003098450.1.98410 WP_003098450.1.98414 WP_003098450.1.98600 WP_003098450.1.98610 WP_003098450.1.9885 WP_003098450.1.98926 WP_003098450.1.98963 WP_003098450.1.99103 WP_003098450.1.99214 WP_003098450.1.99293 WP_003098450.1.99353 WP_003098450.1.99389 WP_003098450.1.99461 WP_003098450.1.9951 WP_003098450.1.99516 WP_003098450.1.99647 WP_003098450.1.99654 WP_003098450.1.99757 WP_003098450.1.99795 WP_003098450.1.99835 WP_003098450.1.9989 WP_003098450.1.99930 gi|15595892|ref|NP_249386.1| 208964.PA0695 557722.PLES_46351 gi|218893347|ref|YP_002442216.1| gi|564954456|ref|YP_008887026.1| gi|568311552|ref|YP_008983821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]