SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155846|ref|YP_008944838.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155846|ref|YP_008944838.1|
Domain Number 1 Region: 8-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.93e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.087
Further Details:      
 
Domain Number 2 Region: 188-305
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.15e-20
Family Reductases 0.08
Further Details:      
 
Domain Number 3 Region: 100-179
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 8.96e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568155846|ref|YP_008944838.1|
Sequence length 308
Comment hypothetical protein T223_24055 [Pseudomonas aeruginosa LES431]
Sequence
MPDIRVGERRLAVAAGSNLLDALLAGGIAVPHSCRAGSCHACLVHCLQGEVDDTLPEALD
PARREAGWRLACQCRVLGDLVLQPFDPERDGLPARVVACHWLGDVLRLRLEPERPLRYRA
GQHLLLWSDDGVARPYSLASLPHEDPWLEFHIDCSAPGAFCDRARRLAPGALLRLGELRG
GALRYEPDWQERPLLLMAAGTGLAPLWGILREALRAEHQAPIQLLHLARDHYLASELAEL
AGRHPQVRVNLVSAAQLPSALADLRLVPRRSMALLCGQPASVERFARHLYLAGVPRSQTL
ADLFLPHA
Download sequence
Identical sequences A0A072ZD30 A0A1E9C1R2 A0A1F0IQF1 A0A1S1C353
gi|218893421|ref|YP_002442290.1| 557722.PLES_47091 gi|568155846|ref|YP_008944838.1| gi|392985892|ref|YP_006484479.1| WP_003101153.1.100071 WP_003101153.1.100100 WP_003101153.1.100276 WP_003101153.1.100420 WP_003101153.1.100473 WP_003101153.1.100523 WP_003101153.1.100654 WP_003101153.1.100786 WP_003101153.1.100810 WP_003101153.1.100872 WP_003101153.1.101090 WP_003101153.1.101340 WP_003101153.1.101572 WP_003101153.1.101712 WP_003101153.1.101739 WP_003101153.1.10179 WP_003101153.1.101819 WP_003101153.1.101863 WP_003101153.1.10201 WP_003101153.1.10204 WP_003101153.1.102045 WP_003101153.1.10257 WP_003101153.1.10468 WP_003101153.1.10477 WP_003101153.1.10572 WP_003101153.1.10641 WP_003101153.1.10901 WP_003101153.1.11026 WP_003101153.1.11058 WP_003101153.1.1107 WP_003101153.1.11077 WP_003101153.1.1109 WP_003101153.1.11163 WP_003101153.1.11381 WP_003101153.1.11454 WP_003101153.1.11568 WP_003101153.1.11653 WP_003101153.1.11744 WP_003101153.1.11754 WP_003101153.1.1180 WP_003101153.1.11847 WP_003101153.1.1187 WP_003101153.1.11943 WP_003101153.1.12120 WP_003101153.1.12208 WP_003101153.1.12240 WP_003101153.1.12302 WP_003101153.1.12354 WP_003101153.1.1238 WP_003101153.1.12797 WP_003101153.1.12838 WP_003101153.1.12873 WP_003101153.1.12891 WP_003101153.1.12970 WP_003101153.1.13 WP_003101153.1.1305 WP_003101153.1.13057 WP_003101153.1.13232 WP_003101153.1.1333 WP_003101153.1.1356 WP_003101153.1.1362 WP_003101153.1.13622 WP_003101153.1.13758 WP_003101153.1.13765 WP_003101153.1.13785 WP_003101153.1.1393 WP_003101153.1.14078 WP_003101153.1.14096 WP_003101153.1.14378 WP_003101153.1.14460 WP_003101153.1.14640 WP_003101153.1.14714 WP_003101153.1.1475 WP_003101153.1.14820 WP_003101153.1.14839 WP_003101153.1.14966 WP_003101153.1.15130 WP_003101153.1.152 WP_003101153.1.15231 WP_003101153.1.15373 WP_003101153.1.15379 WP_003101153.1.15474 WP_003101153.1.15485 WP_003101153.1.15602 WP_003101153.1.15886 WP_003101153.1.15889 WP_003101153.1.16109 WP_003101153.1.16161 WP_003101153.1.162 WP_003101153.1.16242 WP_003101153.1.16267 WP_003101153.1.16279 WP_003101153.1.16419 WP_003101153.1.1646 WP_003101153.1.1671 WP_003101153.1.16782 WP_003101153.1.16808 WP_003101153.1.16895 WP_003101153.1.17022 WP_003101153.1.17155 WP_003101153.1.17162 WP_003101153.1.17353 WP_003101153.1.17354 WP_003101153.1.1739 WP_003101153.1.17697 WP_003101153.1.17883 WP_003101153.1.17890 WP_003101153.1.18117 WP_003101153.1.18234 WP_003101153.1.18493 WP_003101153.1.18547 WP_003101153.1.18728 WP_003101153.1.18735 WP_003101153.1.18769 WP_003101153.1.18852 WP_003101153.1.18930 WP_003101153.1.190 WP_003101153.1.19260 WP_003101153.1.19269 WP_003101153.1.19703 WP_003101153.1.1971 WP_003101153.1.19741 WP_003101153.1.19771 WP_003101153.1.19931 WP_003101153.1.20070 WP_003101153.1.20125 WP_003101153.1.20134 WP_003101153.1.20682 WP_003101153.1.20744 WP_003101153.1.20764 WP_003101153.1.20884 WP_003101153.1.209 WP_003101153.1.20929 WP_003101153.1.21242 WP_003101153.1.21302 WP_003101153.1.21349 WP_003101153.1.21448 WP_003101153.1.21460 WP_003101153.1.21469 WP_003101153.1.21517 WP_003101153.1.21607 WP_003101153.1.2172 WP_003101153.1.21744 WP_003101153.1.21801 WP_003101153.1.21863 WP_003101153.1.21871 WP_003101153.1.21891 WP_003101153.1.21932 WP_003101153.1.22078 WP_003101153.1.221 WP_003101153.1.2228 WP_003101153.1.22324 WP_003101153.1.22365 WP_003101153.1.22442 WP_003101153.1.22477 WP_003101153.1.22573 WP_003101153.1.22704 WP_003101153.1.22863 WP_003101153.1.2289 WP_003101153.1.22891 WP_003101153.1.23013 WP_003101153.1.23195 WP_003101153.1.2323 WP_003101153.1.23331 WP_003101153.1.23394 WP_003101153.1.23418 WP_003101153.1.23512 WP_003101153.1.23525 WP_003101153.1.23559 WP_003101153.1.23581 WP_003101153.1.23611 WP_003101153.1.23641 WP_003101153.1.23715 WP_003101153.1.23739 WP_003101153.1.23769 WP_003101153.1.23782 WP_003101153.1.23794 WP_003101153.1.23884 WP_003101153.1.23925 WP_003101153.1.23961 WP_003101153.1.23967 WP_003101153.1.23983 WP_003101153.1.24066 WP_003101153.1.24087 WP_003101153.1.24351 WP_003101153.1.24447 WP_003101153.1.2453 WP_003101153.1.24662 WP_003101153.1.2477 WP_003101153.1.24851 WP_003101153.1.24938 WP_003101153.1.25033 WP_003101153.1.25067 WP_003101153.1.25075 WP_003101153.1.251 WP_003101153.1.25142 WP_003101153.1.25149 WP_003101153.1.25179 WP_003101153.1.25271 WP_003101153.1.25348 WP_003101153.1.2535 WP_003101153.1.25532 WP_003101153.1.25695 WP_003101153.1.2572 WP_003101153.1.25964 WP_003101153.1.261 WP_003101153.1.26334 WP_003101153.1.26428 WP_003101153.1.2652 WP_003101153.1.26539 WP_003101153.1.26604 WP_003101153.1.26681 WP_003101153.1.26705 WP_003101153.1.26740 WP_003101153.1.26816 WP_003101153.1.26906 WP_003101153.1.2698 WP_003101153.1.27018 WP_003101153.1.27211 WP_003101153.1.27218 WP_003101153.1.27259 WP_003101153.1.27505 WP_003101153.1.27534 WP_003101153.1.27575 WP_003101153.1.27587 WP_003101153.1.27687 WP_003101153.1.27738 WP_003101153.1.27783 WP_003101153.1.27837 WP_003101153.1.27858 WP_003101153.1.27939 WP_003101153.1.28006 WP_003101153.1.28136 WP_003101153.1.28175 WP_003101153.1.28258 WP_003101153.1.28316 WP_003101153.1.28329 WP_003101153.1.28382 WP_003101153.1.28404 WP_003101153.1.28468 WP_003101153.1.28623 WP_003101153.1.28823 WP_003101153.1.28849 WP_003101153.1.29137 WP_003101153.1.29179 WP_003101153.1.29208 WP_003101153.1.29401 WP_003101153.1.29438 WP_003101153.1.29472 WP_003101153.1.2948 WP_003101153.1.29501 WP_003101153.1.29577 WP_003101153.1.2961 WP_003101153.1.29753 WP_003101153.1.29767 WP_003101153.1.2980 WP_003101153.1.30000 WP_003101153.1.30081 WP_003101153.1.30120 WP_003101153.1.30567 WP_003101153.1.30707 WP_003101153.1.3072 WP_003101153.1.30886 WP_003101153.1.31045 WP_003101153.1.31076 WP_003101153.1.31087 WP_003101153.1.31105 WP_003101153.1.31138 WP_003101153.1.31147 WP_003101153.1.31279 WP_003101153.1.31361 WP_003101153.1.31501 WP_003101153.1.31565 WP_003101153.1.31741 WP_003101153.1.31852 WP_003101153.1.31939 WP_003101153.1.32134 WP_003101153.1.32137 WP_003101153.1.32144 WP_003101153.1.32289 WP_003101153.1.32544 WP_003101153.1.32711 WP_003101153.1.32879 WP_003101153.1.33152 WP_003101153.1.33186 WP_003101153.1.33204 WP_003101153.1.33210 WP_003101153.1.33216 WP_003101153.1.33340 WP_003101153.1.33387 WP_003101153.1.33455 WP_003101153.1.33521 WP_003101153.1.33653 WP_003101153.1.33658 WP_003101153.1.33733 WP_003101153.1.33734 WP_003101153.1.33774 WP_003101153.1.33822 WP_003101153.1.34000 WP_003101153.1.34039 WP_003101153.1.34151 WP_003101153.1.34191 WP_003101153.1.34306 WP_003101153.1.34402 WP_003101153.1.34625 WP_003101153.1.34832 WP_003101153.1.34837 WP_003101153.1.34878 WP_003101153.1.34901 WP_003101153.1.35036 WP_003101153.1.35149 WP_003101153.1.35281 WP_003101153.1.3531 WP_003101153.1.35325 WP_003101153.1.35431 WP_003101153.1.35573 WP_003101153.1.35669 WP_003101153.1.35679 WP_003101153.1.35682 WP_003101153.1.3576 WP_003101153.1.35762 WP_003101153.1.35768 WP_003101153.1.35843 WP_003101153.1.35857 WP_003101153.1.35872 WP_003101153.1.35984 WP_003101153.1.36170 WP_003101153.1.36378 WP_003101153.1.36521 WP_003101153.1.36587 WP_003101153.1.36781 WP_003101153.1.36879 WP_003101153.1.37125 WP_003101153.1.37163 WP_003101153.1.37208 WP_003101153.1.3721 WP_003101153.1.37216 WP_003101153.1.37319 WP_003101153.1.37366 WP_003101153.1.37512 WP_003101153.1.3781 WP_003101153.1.37826 WP_003101153.1.37842 WP_003101153.1.3785 WP_003101153.1.3792 WP_003101153.1.38003 WP_003101153.1.38102 WP_003101153.1.38146 WP_003101153.1.38151 WP_003101153.1.38186 WP_003101153.1.38319 WP_003101153.1.3833 WP_003101153.1.38450 WP_003101153.1.38502 WP_003101153.1.38583 WP_003101153.1.38657 WP_003101153.1.38661 WP_003101153.1.38706 WP_003101153.1.38889 WP_003101153.1.38971 WP_003101153.1.39046 WP_003101153.1.39088 WP_003101153.1.39186 WP_003101153.1.39271 WP_003101153.1.39326 WP_003101153.1.39444 WP_003101153.1.39452 WP_003101153.1.39704 WP_003101153.1.39786 WP_003101153.1.3998 WP_003101153.1.40059 WP_003101153.1.40207 WP_003101153.1.40213 WP_003101153.1.40243 WP_003101153.1.40512 WP_003101153.1.40541 WP_003101153.1.40546 WP_003101153.1.4058 WP_003101153.1.40874 WP_003101153.1.40950 WP_003101153.1.40994 WP_003101153.1.41291 WP_003101153.1.41301 WP_003101153.1.41384 WP_003101153.1.41502 WP_003101153.1.4156 WP_003101153.1.41618 WP_003101153.1.41625 WP_003101153.1.41692 WP_003101153.1.41732 WP_003101153.1.41748 WP_003101153.1.41832 WP_003101153.1.41888 WP_003101153.1.4190 WP_003101153.1.42146 WP_003101153.1.42294 WP_003101153.1.42423 WP_003101153.1.42508 WP_003101153.1.42643 WP_003101153.1.42754 WP_003101153.1.42757 WP_003101153.1.42789 WP_003101153.1.42854 WP_003101153.1.42972 WP_003101153.1.43026 WP_003101153.1.43049 WP_003101153.1.43106 WP_003101153.1.43293 WP_003101153.1.43330 WP_003101153.1.43356 WP_003101153.1.4348 WP_003101153.1.43603 WP_003101153.1.43662 WP_003101153.1.43667 WP_003101153.1.43673 WP_003101153.1.43802 WP_003101153.1.43826 WP_003101153.1.44094 WP_003101153.1.44260 WP_003101153.1.44434 WP_003101153.1.44581 WP_003101153.1.44760 WP_003101153.1.4493 WP_003101153.1.44959 WP_003101153.1.45090 WP_003101153.1.45146 WP_003101153.1.45202 WP_003101153.1.4522 WP_003101153.1.4532 WP_003101153.1.45328 WP_003101153.1.45358 WP_003101153.1.45464 WP_003101153.1.45478 WP_003101153.1.45485 WP_003101153.1.45711 WP_003101153.1.45818 WP_003101153.1.45934 WP_003101153.1.46032 WP_003101153.1.461 WP_003101153.1.46152 WP_003101153.1.46200 WP_003101153.1.46502 WP_003101153.1.46623 WP_003101153.1.46755 WP_003101153.1.46826 WP_003101153.1.46926 WP_003101153.1.47101 WP_003101153.1.47155 WP_003101153.1.47158 WP_003101153.1.47312 WP_003101153.1.47469 WP_003101153.1.47480 WP_003101153.1.47527 WP_003101153.1.47645 WP_003101153.1.47774 WP_003101153.1.47930 WP_003101153.1.47970 WP_003101153.1.48001 WP_003101153.1.48086 WP_003101153.1.48094 WP_003101153.1.48172 WP_003101153.1.48178 WP_003101153.1.48334 WP_003101153.1.4836 WP_003101153.1.48378 WP_003101153.1.48382 WP_003101153.1.48474 WP_003101153.1.48545 WP_003101153.1.48747 WP_003101153.1.48820 WP_003101153.1.48842 WP_003101153.1.49265 WP_003101153.1.49286 WP_003101153.1.49293 WP_003101153.1.49416 WP_003101153.1.49500 WP_003101153.1.49557 WP_003101153.1.49688 WP_003101153.1.49798 WP_003101153.1.49833 WP_003101153.1.49988 WP_003101153.1.49998 WP_003101153.1.50176 WP_003101153.1.50222 WP_003101153.1.5043 WP_003101153.1.50665 WP_003101153.1.50682 WP_003101153.1.50734 WP_003101153.1.50967 WP_003101153.1.50989 WP_003101153.1.51019 WP_003101153.1.51136 WP_003101153.1.51183 WP_003101153.1.51267 WP_003101153.1.51538 WP_003101153.1.51682 WP_003101153.1.51807 WP_003101153.1.51847 WP_003101153.1.51937 WP_003101153.1.51976 WP_003101153.1.52244 WP_003101153.1.52334 WP_003101153.1.5235 WP_003101153.1.5258 WP_003101153.1.52583 WP_003101153.1.52690 WP_003101153.1.52697 WP_003101153.1.52700 WP_003101153.1.52784 WP_003101153.1.5294 WP_003101153.1.53070 WP_003101153.1.53169 WP_003101153.1.53267 WP_003101153.1.53351 WP_003101153.1.53371 WP_003101153.1.53427 WP_003101153.1.53530 WP_003101153.1.53663 WP_003101153.1.53719 WP_003101153.1.53726 WP_003101153.1.53932 WP_003101153.1.53948 WP_003101153.1.54090 WP_003101153.1.54140 WP_003101153.1.54146 WP_003101153.1.54497 WP_003101153.1.54742 WP_003101153.1.54809 WP_003101153.1.54974 WP_003101153.1.55089 WP_003101153.1.55169 WP_003101153.1.55400 WP_003101153.1.55729 WP_003101153.1.56013 WP_003101153.1.56145 WP_003101153.1.56187 WP_003101153.1.56228 WP_003101153.1.56229 WP_003101153.1.56315 WP_003101153.1.56348 WP_003101153.1.56442 WP_003101153.1.56474 WP_003101153.1.56475 WP_003101153.1.56768 WP_003101153.1.56797 WP_003101153.1.56819 WP_003101153.1.56973 WP_003101153.1.57005 WP_003101153.1.57113 WP_003101153.1.57276 WP_003101153.1.57480 WP_003101153.1.57566 WP_003101153.1.58183 WP_003101153.1.58193 WP_003101153.1.58228 WP_003101153.1.58436 WP_003101153.1.58482 WP_003101153.1.58689 WP_003101153.1.59013 WP_003101153.1.59076 WP_003101153.1.59176 WP_003101153.1.59246 WP_003101153.1.59250 WP_003101153.1.59563 WP_003101153.1.59831 WP_003101153.1.59870 WP_003101153.1.60051 WP_003101153.1.60085 WP_003101153.1.60415 WP_003101153.1.60600 WP_003101153.1.60602 WP_003101153.1.60603 WP_003101153.1.60639 WP_003101153.1.60686 WP_003101153.1.60916 WP_003101153.1.61130 WP_003101153.1.61209 WP_003101153.1.6130 WP_003101153.1.61431 WP_003101153.1.61493 WP_003101153.1.61598 WP_003101153.1.61696 WP_003101153.1.6173 WP_003101153.1.62035 WP_003101153.1.62180 WP_003101153.1.62211 WP_003101153.1.62410 WP_003101153.1.6242 WP_003101153.1.62483 WP_003101153.1.62516 WP_003101153.1.62534 WP_003101153.1.62635 WP_003101153.1.62688 WP_003101153.1.62701 WP_003101153.1.62704 WP_003101153.1.62768 WP_003101153.1.6280 WP_003101153.1.6283 WP_003101153.1.62834 WP_003101153.1.62873 WP_003101153.1.62917 WP_003101153.1.63041 WP_003101153.1.63193 WP_003101153.1.63196 WP_003101153.1.63338 WP_003101153.1.63597 WP_003101153.1.63634 WP_003101153.1.63659 WP_003101153.1.64155 WP_003101153.1.64198 WP_003101153.1.64309 WP_003101153.1.64591 WP_003101153.1.64726 WP_003101153.1.64748 WP_003101153.1.64799 WP_003101153.1.64807 WP_003101153.1.64854 WP_003101153.1.64862 WP_003101153.1.64885 WP_003101153.1.64983 WP_003101153.1.64984 WP_003101153.1.65095 WP_003101153.1.65099 WP_003101153.1.65145 WP_003101153.1.65227 WP_003101153.1.65247 WP_003101153.1.65334 WP_003101153.1.65335 WP_003101153.1.65549 WP_003101153.1.65642 WP_003101153.1.65740 WP_003101153.1.65819 WP_003101153.1.65867 WP_003101153.1.6589 WP_003101153.1.65926 WP_003101153.1.66277 WP_003101153.1.66348 WP_003101153.1.66364 WP_003101153.1.66526 WP_003101153.1.66721 WP_003101153.1.66892 WP_003101153.1.66929 WP_003101153.1.66950 WP_003101153.1.67188 WP_003101153.1.67192 WP_003101153.1.67205 WP_003101153.1.67261 WP_003101153.1.67370 WP_003101153.1.67388 WP_003101153.1.67472 WP_003101153.1.67526 WP_003101153.1.67531 WP_003101153.1.67686 WP_003101153.1.67755 WP_003101153.1.67830 WP_003101153.1.67903 WP_003101153.1.67948 WP_003101153.1.68000 WP_003101153.1.68158 WP_003101153.1.68183 WP_003101153.1.68252 WP_003101153.1.6850 WP_003101153.1.68568 WP_003101153.1.68756 WP_003101153.1.68781 WP_003101153.1.68800 WP_003101153.1.68850 WP_003101153.1.68862 WP_003101153.1.68910 WP_003101153.1.68938 WP_003101153.1.69088 WP_003101153.1.69159 WP_003101153.1.69260 WP_003101153.1.6928 WP_003101153.1.69534 WP_003101153.1.69599 WP_003101153.1.69702 WP_003101153.1.69819 WP_003101153.1.69907 WP_003101153.1.69993 WP_003101153.1.70092 WP_003101153.1.70098 WP_003101153.1.70194 WP_003101153.1.70229 WP_003101153.1.70460 WP_003101153.1.70470 WP_003101153.1.70561 WP_003101153.1.70648 WP_003101153.1.70670 WP_003101153.1.70693 WP_003101153.1.7077 WP_003101153.1.70778 WP_003101153.1.70991 WP_003101153.1.71038 WP_003101153.1.7128 WP_003101153.1.71642 WP_003101153.1.71806 WP_003101153.1.71822 WP_003101153.1.71891 WP_003101153.1.71934 WP_003101153.1.72167 WP_003101153.1.72181 WP_003101153.1.72287 WP_003101153.1.72323 WP_003101153.1.72331 WP_003101153.1.72541 WP_003101153.1.7276 WP_003101153.1.72768 WP_003101153.1.72772 WP_003101153.1.73048 WP_003101153.1.73135 WP_003101153.1.73149 WP_003101153.1.73172 WP_003101153.1.7327 WP_003101153.1.733 WP_003101153.1.73523 WP_003101153.1.73601 WP_003101153.1.73728 WP_003101153.1.7382 WP_003101153.1.73911 WP_003101153.1.74000 WP_003101153.1.74072 WP_003101153.1.74074 WP_003101153.1.74106 WP_003101153.1.74167 WP_003101153.1.74175 WP_003101153.1.74219 WP_003101153.1.74268 WP_003101153.1.7445 WP_003101153.1.74458 WP_003101153.1.74473 WP_003101153.1.74518 WP_003101153.1.7456 WP_003101153.1.74568 WP_003101153.1.74629 WP_003101153.1.748 WP_003101153.1.75041 WP_003101153.1.75204 WP_003101153.1.75303 WP_003101153.1.7547 WP_003101153.1.75549 WP_003101153.1.75573 WP_003101153.1.75599 WP_003101153.1.75631 WP_003101153.1.75771 WP_003101153.1.75792 WP_003101153.1.75825 WP_003101153.1.75826 WP_003101153.1.75938 WP_003101153.1.75947 WP_003101153.1.7595 WP_003101153.1.76092 WP_003101153.1.76322 WP_003101153.1.76355 WP_003101153.1.76383 WP_003101153.1.76484 WP_003101153.1.76543 WP_003101153.1.76600 WP_003101153.1.76633 WP_003101153.1.76716 WP_003101153.1.76985 WP_003101153.1.77235 WP_003101153.1.77317 WP_003101153.1.77490 WP_003101153.1.77566 WP_003101153.1.77574 WP_003101153.1.77587 WP_003101153.1.77750 WP_003101153.1.77769 WP_003101153.1.77819 WP_003101153.1.78112 WP_003101153.1.78134 WP_003101153.1.78280 WP_003101153.1.78380 WP_003101153.1.78430 WP_003101153.1.78437 WP_003101153.1.78570 WP_003101153.1.78623 WP_003101153.1.78693 WP_003101153.1.78810 WP_003101153.1.78947 WP_003101153.1.78954 WP_003101153.1.79053 WP_003101153.1.79256 WP_003101153.1.79279 WP_003101153.1.79311 WP_003101153.1.79429 WP_003101153.1.79431 WP_003101153.1.7953 WP_003101153.1.79544 WP_003101153.1.79569 WP_003101153.1.79601 WP_003101153.1.79631 WP_003101153.1.79788 WP_003101153.1.79862 WP_003101153.1.79908 WP_003101153.1.79986 WP_003101153.1.80033 WP_003101153.1.80174 WP_003101153.1.8028 WP_003101153.1.80306 WP_003101153.1.80410 WP_003101153.1.80481 WP_003101153.1.8051 WP_003101153.1.80535 WP_003101153.1.80627 WP_003101153.1.80632 WP_003101153.1.8064 WP_003101153.1.80846 WP_003101153.1.80880 WP_003101153.1.80892 WP_003101153.1.80938 WP_003101153.1.81206 WP_003101153.1.81591 WP_003101153.1.81622 WP_003101153.1.81728 WP_003101153.1.81742 WP_003101153.1.81802 WP_003101153.1.81844 WP_003101153.1.81950 WP_003101153.1.81957 WP_003101153.1.81960 WP_003101153.1.81986 WP_003101153.1.82117 WP_003101153.1.82127 WP_003101153.1.82260 WP_003101153.1.82312 WP_003101153.1.82643 WP_003101153.1.82710 WP_003101153.1.82864 WP_003101153.1.82882 WP_003101153.1.83131 WP_003101153.1.83184 WP_003101153.1.83251 WP_003101153.1.83296 WP_003101153.1.83394 WP_003101153.1.835 WP_003101153.1.83698 WP_003101153.1.83715 WP_003101153.1.83946 WP_003101153.1.84008 WP_003101153.1.84190 WP_003101153.1.84203 WP_003101153.1.84271 WP_003101153.1.8437 WP_003101153.1.84374 WP_003101153.1.84398 WP_003101153.1.84404 WP_003101153.1.84439 WP_003101153.1.8453 WP_003101153.1.84674 WP_003101153.1.84702 WP_003101153.1.84754 WP_003101153.1.84792 WP_003101153.1.84937 WP_003101153.1.85018 WP_003101153.1.85290 WP_003101153.1.85303 WP_003101153.1.85318 WP_003101153.1.85788 WP_003101153.1.85897 WP_003101153.1.85910 WP_003101153.1.86002 WP_003101153.1.86058 WP_003101153.1.861 WP_003101153.1.86278 WP_003101153.1.86287 WP_003101153.1.86293 WP_003101153.1.86386 WP_003101153.1.865 WP_003101153.1.86545 WP_003101153.1.86552 WP_003101153.1.86785 WP_003101153.1.86947 WP_003101153.1.86985 WP_003101153.1.87163 WP_003101153.1.8718 WP_003101153.1.87316 WP_003101153.1.87390 WP_003101153.1.87435 WP_003101153.1.87530 WP_003101153.1.87547 WP_003101153.1.87648 WP_003101153.1.87763 WP_003101153.1.87970 WP_003101153.1.87981 WP_003101153.1.87987 WP_003101153.1.88004 WP_003101153.1.88308 WP_003101153.1.88388 WP_003101153.1.88517 WP_003101153.1.88578 WP_003101153.1.88605 WP_003101153.1.88679 WP_003101153.1.88680 WP_003101153.1.88714 WP_003101153.1.89245 WP_003101153.1.89276 WP_003101153.1.89409 WP_003101153.1.89434 WP_003101153.1.89577 WP_003101153.1.89610 WP_003101153.1.89638 WP_003101153.1.89662 WP_003101153.1.89736 WP_003101153.1.89776 WP_003101153.1.89805 WP_003101153.1.89866 WP_003101153.1.89867 WP_003101153.1.89886 WP_003101153.1.90032 WP_003101153.1.90056 WP_003101153.1.90189 WP_003101153.1.90242 WP_003101153.1.90306 WP_003101153.1.90412 WP_003101153.1.9056 WP_003101153.1.90569 WP_003101153.1.90655 WP_003101153.1.90770 WP_003101153.1.90940 WP_003101153.1.91093 WP_003101153.1.91161 WP_003101153.1.91204 WP_003101153.1.9143 WP_003101153.1.91431 WP_003101153.1.91438 WP_003101153.1.91563 WP_003101153.1.91803 WP_003101153.1.9182 WP_003101153.1.91860 WP_003101153.1.91862 WP_003101153.1.92314 WP_003101153.1.92321 WP_003101153.1.92357 WP_003101153.1.92454 WP_003101153.1.92573 WP_003101153.1.92585 WP_003101153.1.92587 WP_003101153.1.92589 WP_003101153.1.9272 WP_003101153.1.92769 WP_003101153.1.92894 WP_003101153.1.92924 WP_003101153.1.93090 WP_003101153.1.93250 WP_003101153.1.9328 WP_003101153.1.93493 WP_003101153.1.93797 WP_003101153.1.93848 WP_003101153.1.94004 WP_003101153.1.94031 WP_003101153.1.94285 WP_003101153.1.94385 WP_003101153.1.9444 WP_003101153.1.94450 WP_003101153.1.94682 WP_003101153.1.94818 WP_003101153.1.94856 WP_003101153.1.94896 WP_003101153.1.94897 WP_003101153.1.95027 WP_003101153.1.95117 WP_003101153.1.95187 WP_003101153.1.95207 WP_003101153.1.95217 WP_003101153.1.95305 WP_003101153.1.95488 WP_003101153.1.95525 WP_003101153.1.95536 WP_003101153.1.95668 WP_003101153.1.95774 WP_003101153.1.95787 WP_003101153.1.95802 WP_003101153.1.95820 WP_003101153.1.95825 WP_003101153.1.9599 WP_003101153.1.95999 WP_003101153.1.9604 WP_003101153.1.96134 WP_003101153.1.96243 WP_003101153.1.96267 WP_003101153.1.96357 WP_003101153.1.96434 WP_003101153.1.96967 WP_003101153.1.9706 WP_003101153.1.97118 WP_003101153.1.97126 WP_003101153.1.97213 WP_003101153.1.9722 WP_003101153.1.97271 WP_003101153.1.97474 WP_003101153.1.97614 WP_003101153.1.97877 WP_003101153.1.97968 WP_003101153.1.98410 WP_003101153.1.98414 WP_003101153.1.98433 WP_003101153.1.98522 WP_003101153.1.98573 WP_003101153.1.98610 WP_003101153.1.98788 WP_003101153.1.98926 WP_003101153.1.98958 WP_003101153.1.99068 WP_003101153.1.99103 WP_003101153.1.99293 WP_003101153.1.99353 WP_003101153.1.99461 WP_003101153.1.99654 WP_003101153.1.99662 WP_003101153.1.99746 WP_003101153.1.99757 WP_003101153.1.99795 gi|386060482|ref|YP_005977004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]