SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155944|ref|YP_008944936.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155944|ref|YP_008944936.1|
Domain Number 1 Region: 78-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.56e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0092
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568155944|ref|YP_008944936.1|
Sequence length 205
Comment stringent starvation protein A [Pseudomonas aeruginosa LES431]
Sequence
MASINKLTCYSDPADHYCHRIRLVLAEKNVAVEVIDIEAGRCPPMLAEVNPYGSVPTLVD
RDLALYEPTVVMEYLDERYPHPPLLPDYPVKRANSRLLIHRIQRDWCSLVDRILDARSKE
AERVQARKELRESLTGVSPLFADKAYFLSEDFSLVDCCLLPILWRLPLLGIELPRQAKPL
LDYMERGFARESFRASLSSVERDMR
Download sequence
Identical sequences A0A072ZEF6 A0A0E1AZ12 A0A0H2ZFM5 A0A0H3QTD7 A0A157V482 A0A1C7B8I3 A0A1E9C276 A0A1F0IQ68 A0A1G5ICK0 A0A1S1C1P9 Q9HVY7 V6AKL6 W1MQ50
gi|218893519|ref|YP_002442388.1| gi|15599624|ref|NP_253118.1| gi|558668256|ref|YP_008804966.1| gi|564954633|ref|YP_008887203.1| gi|386060580|ref|YP_005977102.1| gi|386064127|ref|YP_005979431.1| NP_253118.1.87394 WP_003094155.1.100071 WP_003094155.1.100100 WP_003094155.1.100179 WP_003094155.1.100276 WP_003094155.1.100278 WP_003094155.1.100319 WP_003094155.1.100394 WP_003094155.1.100420 WP_003094155.1.100456 WP_003094155.1.100469 WP_003094155.1.100473 WP_003094155.1.100476 WP_003094155.1.100523 WP_003094155.1.100654 WP_003094155.1.100723 WP_003094155.1.100742 WP_003094155.1.100777 WP_003094155.1.100786 WP_003094155.1.100808 WP_003094155.1.100809 WP_003094155.1.100810 WP_003094155.1.100872 WP_003094155.1.100983 WP_003094155.1.100995 WP_003094155.1.101021 WP_003094155.1.101090 WP_003094155.1.101310 WP_003094155.1.101340 WP_003094155.1.101506 WP_003094155.1.101572 WP_003094155.1.101590 WP_003094155.1.101642 WP_003094155.1.101712 WP_003094155.1.101739 WP_003094155.1.10174 WP_003094155.1.101781 WP_003094155.1.10179 WP_003094155.1.101819 WP_003094155.1.10185 WP_003094155.1.101863 WP_003094155.1.101871 WP_003094155.1.10201 WP_003094155.1.10202 WP_003094155.1.10204 WP_003094155.1.102045 WP_003094155.1.10228 WP_003094155.1.10248 WP_003094155.1.10257 WP_003094155.1.10271 WP_003094155.1.1037 WP_003094155.1.10407 WP_003094155.1.10419 WP_003094155.1.10435 WP_003094155.1.10457 WP_003094155.1.10468 WP_003094155.1.10477 WP_003094155.1.10482 WP_003094155.1.10513 WP_003094155.1.10529 WP_003094155.1.10548 WP_003094155.1.10572 WP_003094155.1.10575 WP_003094155.1.10636 WP_003094155.1.10641 WP_003094155.1.10684 WP_003094155.1.10764 WP_003094155.1.10856 WP_003094155.1.10895 WP_003094155.1.10901 WP_003094155.1.10949 WP_003094155.1.11026 WP_003094155.1.11058 WP_003094155.1.1107 WP_003094155.1.11077 WP_003094155.1.1109 WP_003094155.1.11130 WP_003094155.1.11163 WP_003094155.1.11178 WP_003094155.1.11180 WP_003094155.1.11318 WP_003094155.1.11381 WP_003094155.1.11388 WP_003094155.1.11410 WP_003094155.1.11417 WP_003094155.1.11568 WP_003094155.1.11569 WP_003094155.1.11653 WP_003094155.1.11744 WP_003094155.1.11754 WP_003094155.1.1180 WP_003094155.1.1183 WP_003094155.1.11847 WP_003094155.1.11854 WP_003094155.1.1187 WP_003094155.1.11943 WP_003094155.1.12018 WP_003094155.1.12081 WP_003094155.1.12120 WP_003094155.1.12150 WP_003094155.1.12200 WP_003094155.1.12208 WP_003094155.1.12240 WP_003094155.1.12302 WP_003094155.1.12354 WP_003094155.1.12400 WP_003094155.1.12482 WP_003094155.1.12497 WP_003094155.1.12530 WP_003094155.1.12547 WP_003094155.1.12561 WP_003094155.1.12657 WP_003094155.1.12660 WP_003094155.1.12670 WP_003094155.1.12687 WP_003094155.1.12744 WP_003094155.1.12797 WP_003094155.1.12838 WP_003094155.1.12873 WP_003094155.1.12890 WP_003094155.1.12891 WP_003094155.1.12922 WP_003094155.1.12930 WP_003094155.1.12970 WP_003094155.1.12980 WP_003094155.1.13 WP_003094155.1.13041 WP_003094155.1.1305 WP_003094155.1.13057 WP_003094155.1.13077 WP_003094155.1.13085 WP_003094155.1.13092 WP_003094155.1.13208 WP_003094155.1.13232 WP_003094155.1.13242 WP_003094155.1.13266 WP_003094155.1.13270 WP_003094155.1.13315 WP_003094155.1.1333 WP_003094155.1.13364 WP_003094155.1.13407 WP_003094155.1.13529 WP_003094155.1.13533 WP_003094155.1.1356 WP_003094155.1.1362 WP_003094155.1.13622 WP_003094155.1.13642 WP_003094155.1.13718 WP_003094155.1.13743 WP_003094155.1.13758 WP_003094155.1.13765 WP_003094155.1.13785 WP_003094155.1.13795 WP_003094155.1.13828 WP_003094155.1.13865 WP_003094155.1.1393 WP_003094155.1.14049 WP_003094155.1.14078 WP_003094155.1.14096 WP_003094155.1.14116 WP_003094155.1.14204 WP_003094155.1.14251 WP_003094155.1.14378 WP_003094155.1.14424 WP_003094155.1.14455 WP_003094155.1.14460 WP_003094155.1.14463 WP_003094155.1.14476 WP_003094155.1.14525 WP_003094155.1.14564 WP_003094155.1.14615 WP_003094155.1.14640 WP_003094155.1.14679 WP_003094155.1.14690 WP_003094155.1.14714 WP_003094155.1.1475 WP_003094155.1.14754 WP_003094155.1.14797 WP_003094155.1.14820 WP_003094155.1.14835 WP_003094155.1.14839 WP_003094155.1.14883 WP_003094155.1.14966 WP_003094155.1.15004 WP_003094155.1.15130 WP_003094155.1.1516 WP_003094155.1.15222 WP_003094155.1.15231 WP_003094155.1.15281 WP_003094155.1.15297 WP_003094155.1.15328 WP_003094155.1.15373 WP_003094155.1.15379 WP_003094155.1.15408 WP_003094155.1.15474 WP_003094155.1.15480 WP_003094155.1.15482 WP_003094155.1.15485 WP_003094155.1.15602 WP_003094155.1.15606 WP_003094155.1.15666 WP_003094155.1.15692 WP_003094155.1.15886 WP_003094155.1.15889 WP_003094155.1.15934 WP_003094155.1.16041 WP_003094155.1.16074 WP_003094155.1.16109 WP_003094155.1.16142 WP_003094155.1.16161 WP_003094155.1.16197 WP_003094155.1.162 WP_003094155.1.16239 WP_003094155.1.16242 WP_003094155.1.16267 WP_003094155.1.16279 WP_003094155.1.16419 WP_003094155.1.1646 WP_003094155.1.16660 WP_003094155.1.16694 WP_003094155.1.1670 WP_003094155.1.1671 WP_003094155.1.16751 WP_003094155.1.16782 WP_003094155.1.16788 WP_003094155.1.16801 WP_003094155.1.16808 WP_003094155.1.16811 WP_003094155.1.16895 WP_003094155.1.17022 WP_003094155.1.17108 WP_003094155.1.17155 WP_003094155.1.17162 WP_003094155.1.17177 WP_003094155.1.17189 WP_003094155.1.172 WP_003094155.1.17223 WP_003094155.1.17353 WP_003094155.1.17354 WP_003094155.1.17370 WP_003094155.1.1739 WP_003094155.1.17397 WP_003094155.1.17499 WP_003094155.1.17566 WP_003094155.1.1758 WP_003094155.1.1761 WP_003094155.1.17697 WP_003094155.1.17883 WP_003094155.1.17890 WP_003094155.1.18052 WP_003094155.1.18054 WP_003094155.1.18117 WP_003094155.1.18156 WP_003094155.1.18157 WP_003094155.1.18199 WP_003094155.1.18204 WP_003094155.1.18234 WP_003094155.1.1824 WP_003094155.1.18349 WP_003094155.1.18440 WP_003094155.1.18493 WP_003094155.1.18508 WP_003094155.1.18547 WP_003094155.1.18653 WP_003094155.1.18728 WP_003094155.1.18732 WP_003094155.1.18735 WP_003094155.1.18769 WP_003094155.1.18795 WP_003094155.1.18852 WP_003094155.1.18892 WP_003094155.1.18907 WP_003094155.1.18911 WP_003094155.1.18930 WP_003094155.1.190 WP_003094155.1.19089 WP_003094155.1.19199 WP_003094155.1.19251 WP_003094155.1.19260 WP_003094155.1.19269 WP_003094155.1.19346 WP_003094155.1.19351 WP_003094155.1.19376 WP_003094155.1.1938 WP_003094155.1.19552 WP_003094155.1.19591 WP_003094155.1.19640 WP_003094155.1.19703 WP_003094155.1.1971 WP_003094155.1.19711 WP_003094155.1.19741 WP_003094155.1.19771 WP_003094155.1.19803 WP_003094155.1.19824 WP_003094155.1.19930 WP_003094155.1.20024 WP_003094155.1.20070 WP_003094155.1.2012 WP_003094155.1.20125 WP_003094155.1.20134 WP_003094155.1.20154 WP_003094155.1.20216 WP_003094155.1.20342 WP_003094155.1.20590 WP_003094155.1.20682 WP_003094155.1.20692 WP_003094155.1.20744 WP_003094155.1.20764 WP_003094155.1.20825 WP_003094155.1.20854 WP_003094155.1.20880 WP_003094155.1.20884 WP_003094155.1.20890 WP_003094155.1.209 WP_003094155.1.20929 WP_003094155.1.20978 WP_003094155.1.21002 WP_003094155.1.21039 WP_003094155.1.21100 WP_003094155.1.21166 WP_003094155.1.21209 WP_003094155.1.21242 WP_003094155.1.21253 WP_003094155.1.21302 WP_003094155.1.21358 WP_003094155.1.2144 WP_003094155.1.21448 WP_003094155.1.21460 WP_003094155.1.21471 WP_003094155.1.21517 WP_003094155.1.21607 WP_003094155.1.21718 WP_003094155.1.2172 WP_003094155.1.21744 WP_003094155.1.21767 WP_003094155.1.21782 WP_003094155.1.21801 WP_003094155.1.21863 WP_003094155.1.21871 WP_003094155.1.21891 WP_003094155.1.21932 WP_003094155.1.22078 WP_003094155.1.221 WP_003094155.1.2228 WP_003094155.1.22316 WP_003094155.1.22324 WP_003094155.1.22365 WP_003094155.1.2237 WP_003094155.1.22389 WP_003094155.1.22390 WP_003094155.1.22394 WP_003094155.1.22442 WP_003094155.1.22477 WP_003094155.1.22491 WP_003094155.1.22573 WP_003094155.1.22671 WP_003094155.1.22704 WP_003094155.1.22729 WP_003094155.1.22863 WP_003094155.1.2289 WP_003094155.1.22891 WP_003094155.1.23013 WP_003094155.1.23166 WP_003094155.1.23191 WP_003094155.1.23195 WP_003094155.1.2323 WP_003094155.1.23264 WP_003094155.1.23331 WP_003094155.1.23394 WP_003094155.1.23418 WP_003094155.1.23421 WP_003094155.1.23512 WP_003094155.1.23518 WP_003094155.1.23523 WP_003094155.1.23525 WP_003094155.1.2355 WP_003094155.1.23559 WP_003094155.1.23581 WP_003094155.1.236 WP_003094155.1.23611 WP_003094155.1.23641 WP_003094155.1.23715 WP_003094155.1.23739 WP_003094155.1.2374 WP_003094155.1.23769 WP_003094155.1.23782 WP_003094155.1.23794 WP_003094155.1.23884 WP_003094155.1.23925 WP_003094155.1.23938 WP_003094155.1.23961 WP_003094155.1.23967 WP_003094155.1.23983 WP_003094155.1.24066 WP_003094155.1.24077 WP_003094155.1.24087 WP_003094155.1.24101 WP_003094155.1.24183 WP_003094155.1.24234 WP_003094155.1.24319 WP_003094155.1.24351 WP_003094155.1.24382 WP_003094155.1.24413 WP_003094155.1.24447 WP_003094155.1.2453 WP_003094155.1.24662 WP_003094155.1.2477 WP_003094155.1.24851 WP_003094155.1.24862 WP_003094155.1.24869 WP_003094155.1.24879 WP_003094155.1.24938 WP_003094155.1.24940 WP_003094155.1.25033 WP_003094155.1.25052 WP_003094155.1.25067 WP_003094155.1.25075 WP_003094155.1.251 WP_003094155.1.25109 WP_003094155.1.2511 WP_003094155.1.25142 WP_003094155.1.25149 WP_003094155.1.25179 WP_003094155.1.25191 WP_003094155.1.25271 WP_003094155.1.2529 WP_003094155.1.2530 WP_003094155.1.25328 WP_003094155.1.25344 WP_003094155.1.25348 WP_003094155.1.2535 WP_003094155.1.25477 WP_003094155.1.25532 WP_003094155.1.25600 WP_003094155.1.25675 WP_003094155.1.25695 WP_003094155.1.2572 WP_003094155.1.25834 WP_003094155.1.25903 WP_003094155.1.2596 WP_003094155.1.25964 WP_003094155.1.26010 WP_003094155.1.26025 WP_003094155.1.26042 WP_003094155.1.261 WP_003094155.1.26159 WP_003094155.1.26301 WP_003094155.1.26334 WP_003094155.1.26463 WP_003094155.1.26473 WP_003094155.1.26489 WP_003094155.1.2652 WP_003094155.1.26539 WP_003094155.1.26553 WP_003094155.1.26592 WP_003094155.1.26604 WP_003094155.1.26681 WP_003094155.1.26682 WP_003094155.1.26705 WP_003094155.1.26740 WP_003094155.1.26816 WP_003094155.1.26841 WP_003094155.1.26862 WP_003094155.1.26906 WP_003094155.1.26967 WP_003094155.1.2698 WP_003094155.1.27018 WP_003094155.1.27028 WP_003094155.1.27039 WP_003094155.1.27073 WP_003094155.1.27107 WP_003094155.1.27211 WP_003094155.1.27218 WP_003094155.1.27259 WP_003094155.1.27288 WP_003094155.1.27505 WP_003094155.1.27534 WP_003094155.1.27549 WP_003094155.1.27575 WP_003094155.1.27587 WP_003094155.1.27687 WP_003094155.1.27738 WP_003094155.1.27772 WP_003094155.1.27783 WP_003094155.1.27825 WP_003094155.1.27837 WP_003094155.1.27858 WP_003094155.1.27933 WP_003094155.1.27939 WP_003094155.1.27966 WP_003094155.1.28006 WP_003094155.1.28057 WP_003094155.1.28064 WP_003094155.1.28078 WP_003094155.1.28136 WP_003094155.1.28175 WP_003094155.1.28193 WP_003094155.1.28258 WP_003094155.1.283 WP_003094155.1.28316 WP_003094155.1.28329 WP_003094155.1.28372 WP_003094155.1.28382 WP_003094155.1.28383 WP_003094155.1.28404 WP_003094155.1.28468 WP_003094155.1.28505 WP_003094155.1.28528 WP_003094155.1.28560 WP_003094155.1.28602 WP_003094155.1.28623 WP_003094155.1.28699 WP_003094155.1.28713 WP_003094155.1.28757 WP_003094155.1.28800 WP_003094155.1.28823 WP_003094155.1.28838 WP_003094155.1.28849 WP_003094155.1.28878 WP_003094155.1.28920 WP_003094155.1.29003 WP_003094155.1.29008 WP_003094155.1.29062 WP_003094155.1.29070 WP_003094155.1.29096 WP_003094155.1.29127 WP_003094155.1.29137 WP_003094155.1.29158 WP_003094155.1.29179 WP_003094155.1.29208 WP_003094155.1.2927 WP_003094155.1.29401 WP_003094155.1.2941 WP_003094155.1.29438 WP_003094155.1.29440 WP_003094155.1.29472 WP_003094155.1.2948 WP_003094155.1.29481 WP_003094155.1.29498 WP_003094155.1.29501 WP_003094155.1.29577 WP_003094155.1.2961 WP_003094155.1.29633 WP_003094155.1.29650 WP_003094155.1.29668 WP_003094155.1.29753 WP_003094155.1.29767 WP_003094155.1.2980 WP_003094155.1.29848 WP_003094155.1.29920 WP_003094155.1.29958 WP_003094155.1.29973 WP_003094155.1.30000 WP_003094155.1.30020 WP_003094155.1.30081 WP_003094155.1.30120 WP_003094155.1.3030 WP_003094155.1.30365 WP_003094155.1.30474 WP_003094155.1.30475 WP_003094155.1.30563 WP_003094155.1.30567 WP_003094155.1.30614 WP_003094155.1.30615 WP_003094155.1.30625 WP_003094155.1.30693 WP_003094155.1.30707 WP_003094155.1.3072 WP_003094155.1.30740 WP_003094155.1.30797 WP_003094155.1.30815 WP_003094155.1.30842 WP_003094155.1.30886 WP_003094155.1.30943 WP_003094155.1.30973 WP_003094155.1.30994 WP_003094155.1.31045 WP_003094155.1.31076 WP_003094155.1.31087 WP_003094155.1.31103 WP_003094155.1.31105 WP_003094155.1.31138 WP_003094155.1.31147 WP_003094155.1.31279 WP_003094155.1.31361 WP_003094155.1.31457 WP_003094155.1.31501 WP_003094155.1.31565 WP_003094155.1.31587 WP_003094155.1.31633 WP_003094155.1.31655 WP_003094155.1.3172 WP_003094155.1.31732 WP_003094155.1.31741 WP_003094155.1.31751 WP_003094155.1.3179 WP_003094155.1.31848 WP_003094155.1.31852 WP_003094155.1.3189 WP_003094155.1.319 WP_003094155.1.31939 WP_003094155.1.32134 WP_003094155.1.32144 WP_003094155.1.32235 WP_003094155.1.32289 WP_003094155.1.32359 WP_003094155.1.32447 WP_003094155.1.32523 WP_003094155.1.32544 WP_003094155.1.32596 WP_003094155.1.32626 WP_003094155.1.32637 WP_003094155.1.32641 WP_003094155.1.32821 WP_003094155.1.32869 WP_003094155.1.32879 WP_003094155.1.33009 WP_003094155.1.33047 WP_003094155.1.33097 WP_003094155.1.33133 WP_003094155.1.33152 WP_003094155.1.33186 WP_003094155.1.33204 WP_003094155.1.33210 WP_003094155.1.33216 WP_003094155.1.33294 WP_003094155.1.33340 WP_003094155.1.33387 WP_003094155.1.33438 WP_003094155.1.33441 WP_003094155.1.33455 WP_003094155.1.3351 WP_003094155.1.33517 WP_003094155.1.33521 WP_003094155.1.33523 WP_003094155.1.33547 WP_003094155.1.33549 WP_003094155.1.33653 WP_003094155.1.33658 WP_003094155.1.33669 WP_003094155.1.3368 WP_003094155.1.33728 WP_003094155.1.33733 WP_003094155.1.33734 WP_003094155.1.3376 WP_003094155.1.33774 WP_003094155.1.33814 WP_003094155.1.33822 WP_003094155.1.33833 WP_003094155.1.3385 WP_003094155.1.33945 WP_003094155.1.34000 WP_003094155.1.34039 WP_003094155.1.34136 WP_003094155.1.34143 WP_003094155.1.34150 WP_003094155.1.34151 WP_003094155.1.34180 WP_003094155.1.34191 WP_003094155.1.34203 WP_003094155.1.34306 WP_003094155.1.34317 WP_003094155.1.34324 WP_003094155.1.3436 WP_003094155.1.34401 WP_003094155.1.34402 WP_003094155.1.34461 WP_003094155.1.34465 WP_003094155.1.34472 WP_003094155.1.3452 WP_003094155.1.34556 WP_003094155.1.34568 WP_003094155.1.34583 WP_003094155.1.34625 WP_003094155.1.34670 WP_003094155.1.34689 WP_003094155.1.34784 WP_003094155.1.34821 WP_003094155.1.34832 WP_003094155.1.34836 WP_003094155.1.34837 WP_003094155.1.34876 WP_003094155.1.34878 WP_003094155.1.34901 WP_003094155.1.34922 WP_003094155.1.34942 WP_003094155.1.35036 WP_003094155.1.35104 WP_003094155.1.35149 WP_003094155.1.35231 WP_003094155.1.35281 WP_003094155.1.3531 WP_003094155.1.35325 WP_003094155.1.35353 WP_003094155.1.3540 WP_003094155.1.35431 WP_003094155.1.35442 WP_003094155.1.35480 WP_003094155.1.35512 WP_003094155.1.35529 WP_003094155.1.3555 WP_003094155.1.35573 WP_003094155.1.35599 WP_003094155.1.35639 WP_003094155.1.35641 WP_003094155.1.35669 WP_003094155.1.35679 WP_003094155.1.3568 WP_003094155.1.35682 WP_003094155.1.3576 WP_003094155.1.35762 WP_003094155.1.35768 WP_003094155.1.35843 WP_003094155.1.35857 WP_003094155.1.35872 WP_003094155.1.35968 WP_003094155.1.35984 WP_003094155.1.36064 WP_003094155.1.36121 WP_003094155.1.36148 WP_003094155.1.36170 WP_003094155.1.36266 WP_003094155.1.36267 WP_003094155.1.36285 WP_003094155.1.36378 WP_003094155.1.36435 WP_003094155.1.36487 WP_003094155.1.36521 WP_003094155.1.3653 WP_003094155.1.36587 WP_003094155.1.36608 WP_003094155.1.3662 WP_003094155.1.36630 WP_003094155.1.36665 WP_003094155.1.36708 WP_003094155.1.3672 WP_003094155.1.36756 WP_003094155.1.36781 WP_003094155.1.36879 WP_003094155.1.37050 WP_003094155.1.37097 WP_003094155.1.37125 WP_003094155.1.37163 WP_003094155.1.37172 WP_003094155.1.37208 WP_003094155.1.3721 WP_003094155.1.37216 WP_003094155.1.373 WP_003094155.1.37319 WP_003094155.1.37366 WP_003094155.1.37416 WP_003094155.1.3742 WP_003094155.1.37500 WP_003094155.1.37512 WP_003094155.1.37571 WP_003094155.1.3768 WP_003094155.1.37698 WP_003094155.1.37703 WP_003094155.1.37799 WP_003094155.1.3781 WP_003094155.1.37814 WP_003094155.1.37818 WP_003094155.1.37826 WP_003094155.1.37842 WP_003094155.1.3785 WP_003094155.1.3792 WP_003094155.1.38003 WP_003094155.1.38023 WP_003094155.1.38060 WP_003094155.1.38087 WP_003094155.1.38102 WP_003094155.1.38146 WP_003094155.1.38151 WP_003094155.1.3818 WP_003094155.1.38186 WP_003094155.1.3821 WP_003094155.1.38319 WP_003094155.1.3833 WP_003094155.1.38335 WP_003094155.1.38337 WP_003094155.1.38406 WP_003094155.1.38430 WP_003094155.1.38450 WP_003094155.1.38502 WP_003094155.1.38505 WP_003094155.1.38510 WP_003094155.1.38582 WP_003094155.1.38583 WP_003094155.1.38657 WP_003094155.1.38661 WP_003094155.1.3870 WP_003094155.1.38706 WP_003094155.1.38727 WP_003094155.1.38816 WP_003094155.1.38834 WP_003094155.1.3887 WP_003094155.1.38889 WP_003094155.1.38932 WP_003094155.1.38971 WP_003094155.1.39046 WP_003094155.1.39088 WP_003094155.1.39122 WP_003094155.1.39186 WP_003094155.1.39271 WP_003094155.1.39326 WP_003094155.1.39345 WP_003094155.1.3943 WP_003094155.1.39444 WP_003094155.1.39452 WP_003094155.1.39458 WP_003094155.1.39537 WP_003094155.1.39704 WP_003094155.1.39765 WP_003094155.1.39786 WP_003094155.1.39811 WP_003094155.1.39920 WP_003094155.1.39949 WP_003094155.1.3998 WP_003094155.1.39989 WP_003094155.1.40059 WP_003094155.1.40115 WP_003094155.1.40135 WP_003094155.1.40207 WP_003094155.1.40213 WP_003094155.1.40237 WP_003094155.1.40243 WP_003094155.1.40271 WP_003094155.1.4038 WP_003094155.1.40419 WP_003094155.1.40442 WP_003094155.1.40512 WP_003094155.1.40513 WP_003094155.1.40541 WP_003094155.1.40546 WP_003094155.1.4058 WP_003094155.1.40595 WP_003094155.1.40703 WP_003094155.1.40874 WP_003094155.1.40950 WP_003094155.1.40984 WP_003094155.1.40993 WP_003094155.1.40994 WP_003094155.1.41110 WP_003094155.1.41137 WP_003094155.1.41199 WP_003094155.1.41290 WP_003094155.1.41291 WP_003094155.1.41301 WP_003094155.1.41384 WP_003094155.1.41412 WP_003094155.1.41429 WP_003094155.1.41487 WP_003094155.1.41492 WP_003094155.1.41502 WP_003094155.1.4156 WP_003094155.1.41618 WP_003094155.1.41624 WP_003094155.1.41625 WP_003094155.1.41692 WP_003094155.1.41703 WP_003094155.1.41725 WP_003094155.1.41732 WP_003094155.1.41748 WP_003094155.1.41773 WP_003094155.1.41832 WP_003094155.1.41846 WP_003094155.1.41871 WP_003094155.1.41888 WP_003094155.1.4190 WP_003094155.1.41939 WP_003094155.1.4196 WP_003094155.1.42 WP_003094155.1.42019 WP_003094155.1.42041 WP_003094155.1.42047 WP_003094155.1.42146 WP_003094155.1.42259 WP_003094155.1.42294 WP_003094155.1.42316 WP_003094155.1.42381 WP_003094155.1.42388 WP_003094155.1.42411 WP_003094155.1.42463 WP_003094155.1.42499 WP_003094155.1.42508 WP_003094155.1.42634 WP_003094155.1.42643 WP_003094155.1.42690 WP_003094155.1.42696 WP_003094155.1.42723 WP_003094155.1.4273 WP_003094155.1.42754 WP_003094155.1.42757 WP_003094155.1.42778 WP_003094155.1.42789 WP_003094155.1.42854 WP_003094155.1.42856 WP_003094155.1.42870 WP_003094155.1.42917 WP_003094155.1.42946 WP_003094155.1.42952 WP_003094155.1.42972 WP_003094155.1.42973 WP_003094155.1.43024 WP_003094155.1.43026 WP_003094155.1.43049 WP_003094155.1.43107 WP_003094155.1.43212 WP_003094155.1.43245 WP_003094155.1.43286 WP_003094155.1.43293 WP_003094155.1.43315 WP_003094155.1.43330 WP_003094155.1.43356 WP_003094155.1.4348 WP_003094155.1.43593 WP_003094155.1.43603 WP_003094155.1.43662 WP_003094155.1.43667 WP_003094155.1.43673 WP_003094155.1.43696 WP_003094155.1.43729 WP_003094155.1.43756 WP_003094155.1.43783 WP_003094155.1.43802 WP_003094155.1.4381 WP_003094155.1.43811 WP_003094155.1.43826 WP_003094155.1.4397 WP_003094155.1.4398 WP_003094155.1.43998 WP_003094155.1.44046 WP_003094155.1.44094 WP_003094155.1.44260 WP_003094155.1.44269 WP_003094155.1.44373 WP_003094155.1.44434 WP_003094155.1.44486 WP_003094155.1.445 WP_003094155.1.44552 WP_003094155.1.44563 WP_003094155.1.44565 WP_003094155.1.44581 WP_003094155.1.44725 WP_003094155.1.44739 WP_003094155.1.44760 WP_003094155.1.44804 WP_003094155.1.44870 WP_003094155.1.44959 WP_003094155.1.45063 WP_003094155.1.45090 WP_003094155.1.45146 WP_003094155.1.45199 WP_003094155.1.45202 WP_003094155.1.45228 WP_003094155.1.45298 WP_003094155.1.45306 WP_003094155.1.45312 WP_003094155.1.4532 WP_003094155.1.45328 WP_003094155.1.45353 WP_003094155.1.45358 WP_003094155.1.45464 WP_003094155.1.45478 WP_003094155.1.45485 WP_003094155.1.45604 WP_003094155.1.45611 WP_003094155.1.45635 WP_003094155.1.45636 WP_003094155.1.45678 WP_003094155.1.45700 WP_003094155.1.45711 WP_003094155.1.45723 WP_003094155.1.45818 WP_003094155.1.45837 WP_003094155.1.45920 WP_003094155.1.45934 WP_003094155.1.45946 WP_003094155.1.45961 WP_003094155.1.46010 WP_003094155.1.46032 WP_003094155.1.46093 WP_003094155.1.461 WP_003094155.1.46152 WP_003094155.1.46200 WP_003094155.1.46306 WP_003094155.1.4640 WP_003094155.1.46436 WP_003094155.1.46502 WP_003094155.1.46633 WP_003094155.1.46755 WP_003094155.1.46787 WP_003094155.1.46826 WP_003094155.1.46846 WP_003094155.1.46866 WP_003094155.1.46885 WP_003094155.1.46926 WP_003094155.1.46935 WP_003094155.1.4699 WP_003094155.1.47101 WP_003094155.1.47150 WP_003094155.1.47155 WP_003094155.1.47158 WP_003094155.1.47251 WP_003094155.1.4726 WP_003094155.1.47296 WP_003094155.1.47312 WP_003094155.1.47314 WP_003094155.1.47374 WP_003094155.1.47469 WP_003094155.1.47480 WP_003094155.1.47527 WP_003094155.1.47551 WP_003094155.1.47598 WP_003094155.1.47645 WP_003094155.1.47774 WP_003094155.1.47930 WP_003094155.1.47934 WP_003094155.1.47970 WP_003094155.1.48001 WP_003094155.1.48024 WP_003094155.1.48086 WP_003094155.1.48094 WP_003094155.1.48141 WP_003094155.1.48172 WP_003094155.1.48178 WP_003094155.1.48321 WP_003094155.1.48334 WP_003094155.1.4836 WP_003094155.1.48378 WP_003094155.1.48382 WP_003094155.1.48413 WP_003094155.1.48472 WP_003094155.1.48474 WP_003094155.1.48487 WP_003094155.1.48545 WP_003094155.1.48546 WP_003094155.1.48576 WP_003094155.1.48579 WP_003094155.1.48810 WP_003094155.1.48820 WP_003094155.1.48840 WP_003094155.1.48842 WP_003094155.1.48851 WP_003094155.1.48870 WP_003094155.1.49108 WP_003094155.1.4913 WP_003094155.1.49135 WP_003094155.1.49184 WP_003094155.1.49244 WP_003094155.1.49265 WP_003094155.1.49266 WP_003094155.1.49277 WP_003094155.1.49286 WP_003094155.1.49293 WP_003094155.1.49360 WP_003094155.1.49416 WP_003094155.1.49500 WP_003094155.1.49557 WP_003094155.1.49566 WP_003094155.1.49688 WP_003094155.1.49798 WP_003094155.1.49806 WP_003094155.1.49833 WP_003094155.1.49842 WP_003094155.1.49922 WP_003094155.1.49948 WP_003094155.1.49976 WP_003094155.1.49988 WP_003094155.1.49998 WP_003094155.1.50176 WP_003094155.1.50180 WP_003094155.1.50222 WP_003094155.1.50232 WP_003094155.1.50242 WP_003094155.1.5043 WP_003094155.1.50450 WP_003094155.1.50459 WP_003094155.1.50567 WP_003094155.1.50653 WP_003094155.1.50665 WP_003094155.1.50668 WP_003094155.1.50682 WP_003094155.1.50691 WP_003094155.1.50734 WP_003094155.1.50783 WP_003094155.1.50814 WP_003094155.1.50922 WP_003094155.1.50967 WP_003094155.1.51019 WP_003094155.1.51035 WP_003094155.1.51136 WP_003094155.1.51141 WP_003094155.1.51173 WP_003094155.1.51183 WP_003094155.1.51185 WP_003094155.1.51267 WP_003094155.1.51273 WP_003094155.1.5132 WP_003094155.1.51457 WP_003094155.1.51472 WP_003094155.1.51501 WP_003094155.1.51538 WP_003094155.1.51549 WP_003094155.1.51585 WP_003094155.1.51682 WP_003094155.1.51727 WP_003094155.1.51733 WP_003094155.1.51807 WP_003094155.1.51847 WP_003094155.1.51889 WP_003094155.1.51917 WP_003094155.1.51928 WP_003094155.1.51937 WP_003094155.1.51943 WP_003094155.1.51957 WP_003094155.1.51976 WP_003094155.1.52043 WP_003094155.1.52146 WP_003094155.1.52152 WP_003094155.1.52212 WP_003094155.1.52220 WP_003094155.1.52244 WP_003094155.1.5226 WP_003094155.1.52326 WP_003094155.1.52334 WP_003094155.1.5235 WP_003094155.1.52355 WP_003094155.1.52372 WP_003094155.1.52403 WP_003094155.1.52409 WP_003094155.1.52449 WP_003094155.1.52500 WP_003094155.1.52537 WP_003094155.1.5258 WP_003094155.1.52583 WP_003094155.1.52591 WP_003094155.1.5260 WP_003094155.1.52690 WP_003094155.1.52697 WP_003094155.1.52700 WP_003094155.1.52728 WP_003094155.1.52784 WP_003094155.1.52790 WP_003094155.1.52810 WP_003094155.1.52850 WP_003094155.1.5289 WP_003094155.1.52939 WP_003094155.1.5294 WP_003094155.1.53037 WP_003094155.1.53038 WP_003094155.1.53070 WP_003094155.1.53072 WP_003094155.1.53267 WP_003094155.1.53287 WP_003094155.1.53351 WP_003094155.1.53371 WP_003094155.1.53414 WP_003094155.1.53427 WP_003094155.1.53486 WP_003094155.1.53528 WP_003094155.1.53530 WP_003094155.1.53586 WP_003094155.1.53663 WP_003094155.1.53678 WP_003094155.1.53719 WP_003094155.1.53726 WP_003094155.1.53826 WP_003094155.1.5388 WP_003094155.1.53932 WP_003094155.1.53946 WP_003094155.1.53948 WP_003094155.1.53951 WP_003094155.1.5399 WP_003094155.1.54003 WP_003094155.1.54076 WP_003094155.1.54078 WP_003094155.1.54090 WP_003094155.1.54133 WP_003094155.1.54140 WP_003094155.1.54146 WP_003094155.1.5420 WP_003094155.1.54248 WP_003094155.1.5427 WP_003094155.1.54293 WP_003094155.1.54354 WP_003094155.1.54462 WP_003094155.1.54497 WP_003094155.1.54742 WP_003094155.1.54809 WP_003094155.1.55 WP_003094155.1.55089 WP_003094155.1.55169 WP_003094155.1.55318 WP_003094155.1.55347 WP_003094155.1.55387 WP_003094155.1.55400 WP_003094155.1.55445 WP_003094155.1.55478 WP_003094155.1.55543 WP_003094155.1.55729 WP_003094155.1.55813 WP_003094155.1.55976 WP_003094155.1.56013 WP_003094155.1.56037 WP_003094155.1.56145 WP_003094155.1.56171 WP_003094155.1.56187 WP_003094155.1.56188 WP_003094155.1.56196 WP_003094155.1.56228 WP_003094155.1.56229 WP_003094155.1.56315 WP_003094155.1.56348 WP_003094155.1.56442 WP_003094155.1.56452 WP_003094155.1.56465 WP_003094155.1.56474 WP_003094155.1.56475 WP_003094155.1.56623 WP_003094155.1.56626 WP_003094155.1.56632 WP_003094155.1.56745 WP_003094155.1.56768 WP_003094155.1.56797 WP_003094155.1.56808 WP_003094155.1.56819 WP_003094155.1.56837 WP_003094155.1.56864 WP_003094155.1.56896 WP_003094155.1.56973 WP_003094155.1.57005 WP_003094155.1.57020 WP_003094155.1.57065 WP_003094155.1.57113 WP_003094155.1.57131 WP_003094155.1.57140 WP_003094155.1.57276 WP_003094155.1.57339 WP_003094155.1.57369 WP_003094155.1.57417 WP_003094155.1.57460 WP_003094155.1.57477 WP_003094155.1.57480 WP_003094155.1.57532 WP_003094155.1.57548 WP_003094155.1.57566 WP_003094155.1.57728 WP_003094155.1.57792 WP_003094155.1.57839 WP_003094155.1.57841 WP_003094155.1.57853 WP_003094155.1.57921 WP_003094155.1.57966 WP_003094155.1.58019 WP_003094155.1.58155 WP_003094155.1.58162 WP_003094155.1.58183 WP_003094155.1.58193 WP_003094155.1.58200 WP_003094155.1.58294 WP_003094155.1.58360 WP_003094155.1.58417 WP_003094155.1.58436 WP_003094155.1.58482 WP_003094155.1.5850 WP_003094155.1.58510 WP_003094155.1.58527 WP_003094155.1.5856 WP_003094155.1.58581 WP_003094155.1.58689 WP_003094155.1.5869 WP_003094155.1.58785 WP_003094155.1.58800 WP_003094155.1.58838 WP_003094155.1.58845 WP_003094155.1.5889 WP_003094155.1.58944 WP_003094155.1.58952 WP_003094155.1.5897 WP_003094155.1.59013 WP_003094155.1.59076 WP_003094155.1.59099 WP_003094155.1.59123 WP_003094155.1.59156 WP_003094155.1.59158 WP_003094155.1.59176 WP_003094155.1.59212 WP_003094155.1.59246 WP_003094155.1.59249 WP_003094155.1.59250 WP_003094155.1.59288 WP_003094155.1.59339 WP_003094155.1.5937 WP_003094155.1.59385 WP_003094155.1.594 WP_003094155.1.59469 WP_003094155.1.59563 WP_003094155.1.59688 WP_003094155.1.59724 WP_003094155.1.59759 WP_003094155.1.59797 WP_003094155.1.59831 WP_003094155.1.59870 WP_003094155.1.59943 WP_003094155.1.60051 WP_003094155.1.60062 WP_003094155.1.60079 WP_003094155.1.60082 WP_003094155.1.60084 WP_003094155.1.60085 WP_003094155.1.60206 WP_003094155.1.60261 WP_003094155.1.60347 WP_003094155.1.60396 WP_003094155.1.60415 WP_003094155.1.60467 WP_003094155.1.60472 WP_003094155.1.60509 WP_003094155.1.60600 WP_003094155.1.60602 WP_003094155.1.60603 WP_003094155.1.60639 WP_003094155.1.60679 WP_003094155.1.60686 WP_003094155.1.607 WP_003094155.1.60910 WP_003094155.1.60916 WP_003094155.1.60970 WP_003094155.1.60979 WP_003094155.1.61122 WP_003094155.1.61130 WP_003094155.1.61191 WP_003094155.1.61209 WP_003094155.1.61222 WP_003094155.1.61269 WP_003094155.1.61288 WP_003094155.1.61294 WP_003094155.1.61299 WP_003094155.1.6130 WP_003094155.1.61366 WP_003094155.1.61431 WP_003094155.1.61493 WP_003094155.1.61549 WP_003094155.1.61589 WP_003094155.1.61598 WP_003094155.1.616 WP_003094155.1.61696 WP_003094155.1.6173 WP_003094155.1.61943 WP_003094155.1.62010 WP_003094155.1.62035 WP_003094155.1.62180 WP_003094155.1.62186 WP_003094155.1.62211 WP_003094155.1.62263 WP_003094155.1.62357 WP_003094155.1.62396 WP_003094155.1.6242 WP_003094155.1.62483 WP_003094155.1.62516 WP_003094155.1.62534 WP_003094155.1.626 WP_003094155.1.62604 WP_003094155.1.62635 WP_003094155.1.62701 WP_003094155.1.62703 WP_003094155.1.62704 WP_003094155.1.62708 WP_003094155.1.62716 WP_003094155.1.62768 WP_003094155.1.62772 WP_003094155.1.6280 WP_003094155.1.6283 WP_003094155.1.62834 WP_003094155.1.62838 WP_003094155.1.62873 WP_003094155.1.62917 WP_003094155.1.62961 WP_003094155.1.62977 WP_003094155.1.63038 WP_003094155.1.63041 WP_003094155.1.63057 WP_003094155.1.63124 WP_003094155.1.63193 WP_003094155.1.63196 WP_003094155.1.63338 WP_003094155.1.63369 WP_003094155.1.63401 WP_003094155.1.63591 WP_003094155.1.63597 WP_003094155.1.63634 WP_003094155.1.63659 WP_003094155.1.63739 WP_003094155.1.63929 WP_003094155.1.63941 WP_003094155.1.63995 WP_003094155.1.64139 WP_003094155.1.64155 WP_003094155.1.64198 WP_003094155.1.64309 WP_003094155.1.64329 WP_003094155.1.64340 WP_003094155.1.64433 WP_003094155.1.6450 WP_003094155.1.64544 WP_003094155.1.64591 WP_003094155.1.64603 WP_003094155.1.64605 WP_003094155.1.6461 WP_003094155.1.64611 WP_003094155.1.64726 WP_003094155.1.64748 WP_003094155.1.64799 WP_003094155.1.64807 WP_003094155.1.64854 WP_003094155.1.64862 WP_003094155.1.64880 WP_003094155.1.64885 WP_003094155.1.64886 WP_003094155.1.64983 WP_003094155.1.64984 WP_003094155.1.65009 WP_003094155.1.65066 WP_003094155.1.65092 WP_003094155.1.65095 WP_003094155.1.65099 WP_003094155.1.65145 WP_003094155.1.65196 WP_003094155.1.65197 WP_003094155.1.65227 WP_003094155.1.65237 WP_003094155.1.65247 WP_003094155.1.65285 WP_003094155.1.65304 WP_003094155.1.65312 WP_003094155.1.65316 WP_003094155.1.65334 WP_003094155.1.65335 WP_003094155.1.65337 WP_003094155.1.65457 WP_003094155.1.65478 WP_003094155.1.65549 WP_003094155.1.65588 WP_003094155.1.65632 WP_003094155.1.65642 WP_003094155.1.65679 WP_003094155.1.65740 WP_003094155.1.65779 WP_003094155.1.65819 WP_003094155.1.65867 WP_003094155.1.6589 WP_003094155.1.65926 WP_003094155.1.66062 WP_003094155.1.66088 WP_003094155.1.66155 WP_003094155.1.66165 WP_003094155.1.6627 WP_003094155.1.66277 WP_003094155.1.6629 WP_003094155.1.66345 WP_003094155.1.66348 WP_003094155.1.66364 WP_003094155.1.66371 WP_003094155.1.66410 WP_003094155.1.66526 WP_003094155.1.66563 WP_003094155.1.66634 WP_003094155.1.66693 WP_003094155.1.66721 WP_003094155.1.66892 WP_003094155.1.66929 WP_003094155.1.66931 WP_003094155.1.66945 WP_003094155.1.66950 WP_003094155.1.66982 WP_003094155.1.67010 WP_003094155.1.67124 WP_003094155.1.67188 WP_003094155.1.67192 WP_003094155.1.67205 WP_003094155.1.67261 WP_003094155.1.67269 WP_003094155.1.6734 WP_003094155.1.67370 WP_003094155.1.67388 WP_003094155.1.67472 WP_003094155.1.67489 WP_003094155.1.67506 WP_003094155.1.67526 WP_003094155.1.67531 WP_003094155.1.67545 WP_003094155.1.6768 WP_003094155.1.67686 WP_003094155.1.67755 WP_003094155.1.67830 WP_003094155.1.67874 WP_003094155.1.67875 WP_003094155.1.67899 WP_003094155.1.67903 WP_003094155.1.67937 WP_003094155.1.67948 WP_003094155.1.6796 WP_003094155.1.68000 WP_003094155.1.6808 WP_003094155.1.68158 WP_003094155.1.68162 WP_003094155.1.68172 WP_003094155.1.68183 WP_003094155.1.68194 WP_003094155.1.68252 WP_003094155.1.68317 WP_003094155.1.68446 WP_003094155.1.68448 WP_003094155.1.68472 WP_003094155.1.68499 WP_003094155.1.6850 WP_003094155.1.68541 WP_003094155.1.68561 WP_003094155.1.68568 WP_003094155.1.68638 WP_003094155.1.6866 WP_003094155.1.68756 WP_003094155.1.68781 WP_003094155.1.68790 WP_003094155.1.68800 WP_003094155.1.68802 WP_003094155.1.68850 WP_003094155.1.68857 WP_003094155.1.68862 WP_003094155.1.68881 WP_003094155.1.68910 WP_003094155.1.68938 WP_003094155.1.68979 WP_003094155.1.69088 WP_003094155.1.6911 WP_003094155.1.69159 WP_003094155.1.69260 WP_003094155.1.6928 WP_003094155.1.6931 WP_003094155.1.6937 WP_003094155.1.69411 WP_003094155.1.69534 WP_003094155.1.69556 WP_003094155.1.69599 WP_003094155.1.69702 WP_003094155.1.69788 WP_003094155.1.69791 WP_003094155.1.69819 WP_003094155.1.69834 WP_003094155.1.69907 WP_003094155.1.69993 WP_003094155.1.70092 WP_003094155.1.70098 WP_003094155.1.70138 WP_003094155.1.70168 WP_003094155.1.70194 WP_003094155.1.70216 WP_003094155.1.70229 WP_003094155.1.70331 WP_003094155.1.70470 WP_003094155.1.70537 WP_003094155.1.70561 WP_003094155.1.70583 WP_003094155.1.70648 WP_003094155.1.70650 WP_003094155.1.70670 WP_003094155.1.70677 WP_003094155.1.70693 WP_003094155.1.7077 WP_003094155.1.70778 WP_003094155.1.70831 WP_003094155.1.70991 WP_003094155.1.71038 WP_003094155.1.71141 WP_003094155.1.71203 WP_003094155.1.71249 WP_003094155.1.71254 WP_003094155.1.7128 WP_003094155.1.71290 WP_003094155.1.71346 WP_003094155.1.71385 WP_003094155.1.71412 WP_003094155.1.71570 WP_003094155.1.71610 WP_003094155.1.7163 WP_003094155.1.71642 WP_003094155.1.71666 WP_003094155.1.71738 WP_003094155.1.71799 WP_003094155.1.71806 WP_003094155.1.71822 WP_003094155.1.71862 WP_003094155.1.71891 WP_003094155.1.71927 WP_003094155.1.71934 WP_003094155.1.72149 WP_003094155.1.72167 WP_003094155.1.72181 WP_003094155.1.72183 WP_003094155.1.7219 WP_003094155.1.72287 WP_003094155.1.72323 WP_003094155.1.72331 WP_003094155.1.72346 WP_003094155.1.72378 WP_003094155.1.72447 WP_003094155.1.72458 WP_003094155.1.72562 WP_003094155.1.72570 WP_003094155.1.72653 WP_003094155.1.72662 WP_003094155.1.72669 WP_003094155.1.7276 WP_003094155.1.72768 WP_003094155.1.72772 WP_003094155.1.72782 WP_003094155.1.72845 WP_003094155.1.72920 WP_003094155.1.73035 WP_003094155.1.73048 WP_003094155.1.7308 WP_003094155.1.73135 WP_003094155.1.73149 WP_003094155.1.73172 WP_003094155.1.73192 WP_003094155.1.7327 WP_003094155.1.7329 WP_003094155.1.733 WP_003094155.1.73455 WP_003094155.1.73490 WP_003094155.1.73523 WP_003094155.1.73541 WP_003094155.1.73601 WP_003094155.1.73651 WP_003094155.1.73719 WP_003094155.1.73728 WP_003094155.1.7377 WP_003094155.1.73791 WP_003094155.1.7382 WP_003094155.1.73860 WP_003094155.1.73889 WP_003094155.1.73911 WP_003094155.1.73941 WP_003094155.1.74 WP_003094155.1.74000 WP_003094155.1.74072 WP_003094155.1.74074 WP_003094155.1.7408 WP_003094155.1.74106 WP_003094155.1.74167 WP_003094155.1.74175 WP_003094155.1.74180 WP_003094155.1.74182 WP_003094155.1.74219 WP_003094155.1.74264 WP_003094155.1.74268 WP_003094155.1.74281 WP_003094155.1.74287 WP_003094155.1.74326 WP_003094155.1.7445 WP_003094155.1.74458 WP_003094155.1.74473 WP_003094155.1.74475 WP_003094155.1.7448 WP_003094155.1.74518 WP_003094155.1.7456 WP_003094155.1.74568 WP_003094155.1.74604 WP_003094155.1.74629 WP_003094155.1.74637 WP_003094155.1.74685 WP_003094155.1.74772 WP_003094155.1.74776 WP_003094155.1.748 WP_003094155.1.74878 WP_003094155.1.74941 WP_003094155.1.74948 WP_003094155.1.74958 WP_003094155.1.7501 WP_003094155.1.75041 WP_003094155.1.75119 WP_003094155.1.75204 WP_003094155.1.75277 WP_003094155.1.75303 WP_003094155.1.75389 WP_003094155.1.75431 WP_003094155.1.7547 WP_003094155.1.75549 WP_003094155.1.75573 WP_003094155.1.75580 WP_003094155.1.75599 WP_003094155.1.75603 WP_003094155.1.75631 WP_003094155.1.7568 WP_003094155.1.75756 WP_003094155.1.75771 WP_003094155.1.75792 WP_003094155.1.75825 WP_003094155.1.75826 WP_003094155.1.75860 WP_003094155.1.75935 WP_003094155.1.75938 WP_003094155.1.75947 WP_003094155.1.7595 WP_003094155.1.76077 WP_003094155.1.76092 WP_003094155.1.76141 WP_003094155.1.76145 WP_003094155.1.76192 WP_003094155.1.76322 WP_003094155.1.76355 WP_003094155.1.76383 WP_003094155.1.76399 WP_003094155.1.76441 WP_003094155.1.76467 WP_003094155.1.76484 WP_003094155.1.76543 WP_003094155.1.76600 WP_003094155.1.76633 WP_003094155.1.7666 WP_003094155.1.76716 WP_003094155.1.76775 WP_003094155.1.76791 WP_003094155.1.76861 WP_003094155.1.76922 WP_003094155.1.76985 WP_003094155.1.77235 WP_003094155.1.77238 WP_003094155.1.77286 WP_003094155.1.77317 WP_003094155.1.77442 WP_003094155.1.77476 WP_003094155.1.77490 WP_003094155.1.77566 WP_003094155.1.77574 WP_003094155.1.77587 WP_003094155.1.77686 WP_003094155.1.77750 WP_003094155.1.77769 WP_003094155.1.7779 WP_003094155.1.77819 WP_003094155.1.77834 WP_003094155.1.77913 WP_003094155.1.78104 WP_003094155.1.78112 WP_003094155.1.78118 WP_003094155.1.78134 WP_003094155.1.78148 WP_003094155.1.78158 WP_003094155.1.78280 WP_003094155.1.78288 WP_003094155.1.78380 WP_003094155.1.7840 WP_003094155.1.78409 WP_003094155.1.78425 WP_003094155.1.78430 WP_003094155.1.78437 WP_003094155.1.78570 WP_003094155.1.78623 WP_003094155.1.78669 WP_003094155.1.78693 WP_003094155.1.78795 WP_003094155.1.788 WP_003094155.1.78810 WP_003094155.1.78926 WP_003094155.1.78947 WP_003094155.1.78986 WP_003094155.1.7899 WP_003094155.1.79003 WP_003094155.1.79007 WP_003094155.1.79053 WP_003094155.1.79060 WP_003094155.1.79177 WP_003094155.1.79193 WP_003094155.1.79256 WP_003094155.1.79279 WP_003094155.1.79286 WP_003094155.1.79311 WP_003094155.1.79357 WP_003094155.1.79364 WP_003094155.1.79421 WP_003094155.1.79429 WP_003094155.1.79431 WP_003094155.1.7945 WP_003094155.1.79463 WP_003094155.1.79507 WP_003094155.1.7953 WP_003094155.1.79544 WP_003094155.1.79569 WP_003094155.1.79601 WP_003094155.1.79631 WP_003094155.1.79699 WP_003094155.1.79754 WP_003094155.1.79788 WP_003094155.1.79862 WP_003094155.1.79883 WP_003094155.1.799 WP_003094155.1.79902 WP_003094155.1.79908 WP_003094155.1.8 WP_003094155.1.80033 WP_003094155.1.80068 WP_003094155.1.80087 WP_003094155.1.80102 WP_003094155.1.8013 WP_003094155.1.80174 WP_003094155.1.80258 WP_003094155.1.8028 WP_003094155.1.80306 WP_003094155.1.8038 WP_003094155.1.80410 WP_003094155.1.80411 WP_003094155.1.80454 WP_003094155.1.80481 WP_003094155.1.8051 WP_003094155.1.80535 WP_003094155.1.80572 WP_003094155.1.80627 WP_003094155.1.80632 WP_003094155.1.8064 WP_003094155.1.80644 WP_003094155.1.80645 WP_003094155.1.80683 WP_003094155.1.80715 WP_003094155.1.80720 WP_003094155.1.80785 WP_003094155.1.80846 WP_003094155.1.80880 WP_003094155.1.80892 WP_003094155.1.80926 WP_003094155.1.80929 WP_003094155.1.80931 WP_003094155.1.80938 WP_003094155.1.80969 WP_003094155.1.81081 WP_003094155.1.81082 WP_003094155.1.8110 WP_003094155.1.81206 WP_003094155.1.81237 WP_003094155.1.81331 WP_003094155.1.81338 WP_003094155.1.81349 WP_003094155.1.81368 WP_003094155.1.81380 WP_003094155.1.8141 WP_003094155.1.81426 WP_003094155.1.81470 WP_003094155.1.81482 WP_003094155.1.81487 WP_003094155.1.81581 WP_003094155.1.81591 WP_003094155.1.81622 WP_003094155.1.81643 WP_003094155.1.81708 WP_003094155.1.81728 WP_003094155.1.81742 WP_003094155.1.81748 WP_003094155.1.81771 WP_003094155.1.81784 WP_003094155.1.81802 WP_003094155.1.81816 WP_003094155.1.81834 WP_003094155.1.81844 WP_003094155.1.81856 WP_003094155.1.81874 WP_003094155.1.81927 WP_003094155.1.81950 WP_003094155.1.81957 WP_003094155.1.81960 WP_003094155.1.81986 WP_003094155.1.82117 WP_003094155.1.82127 WP_003094155.1.82178 WP_003094155.1.82260 WP_003094155.1.8227 WP_003094155.1.82310 WP_003094155.1.82312 WP_003094155.1.82328 WP_003094155.1.82334 WP_003094155.1.8238 WP_003094155.1.82442 WP_003094155.1.82487 WP_003094155.1.82580 WP_003094155.1.82604 WP_003094155.1.82606 WP_003094155.1.82620 WP_003094155.1.82643 WP_003094155.1.82686 WP_003094155.1.82710 WP_003094155.1.82798 WP_003094155.1.82810 WP_003094155.1.8284 WP_003094155.1.82864 WP_003094155.1.82882 WP_003094155.1.82887 WP_003094155.1.82936 WP_003094155.1.83025 WP_003094155.1.83131 WP_003094155.1.83184 WP_003094155.1.83213 WP_003094155.1.83251 WP_003094155.1.83267 WP_003094155.1.83296 WP_003094155.1.83317 WP_003094155.1.83394 WP_003094155.1.83440 WP_003094155.1.83460 WP_003094155.1.83463 WP_003094155.1.835 WP_003094155.1.83503 WP_003094155.1.8351 WP_003094155.1.8353 WP_003094155.1.83534 WP_003094155.1.83540 WP_003094155.1.8357 WP_003094155.1.83637 WP_003094155.1.83673 WP_003094155.1.83698 WP_003094155.1.83715 WP_003094155.1.83871 WP_003094155.1.83937 WP_003094155.1.83946 WP_003094155.1.84003 WP_003094155.1.84008 WP_003094155.1.84138 WP_003094155.1.84162 WP_003094155.1.84174 WP_003094155.1.84177 WP_003094155.1.84178 WP_003094155.1.84190 WP_003094155.1.84203 WP_003094155.1.84271 WP_003094155.1.84297 WP_003094155.1.8437 WP_003094155.1.84374 WP_003094155.1.84398 WP_003094155.1.84404 WP_003094155.1.84439 WP_003094155.1.84471 WP_003094155.1.84487 WP_003094155.1.84526 WP_003094155.1.8453 WP_003094155.1.84538 WP_003094155.1.84558 WP_003094155.1.84589 WP_003094155.1.84674 WP_003094155.1.84684 WP_003094155.1.84702 WP_003094155.1.84715 WP_003094155.1.84754 WP_003094155.1.84792 WP_003094155.1.84825 WP_003094155.1.8484 WP_003094155.1.84865 WP_003094155.1.84937 WP_003094155.1.84946 WP_003094155.1.8498 WP_003094155.1.85018 WP_003094155.1.85028 WP_003094155.1.85059 WP_003094155.1.85150 WP_003094155.1.85220 WP_003094155.1.85290 WP_003094155.1.85298 WP_003094155.1.85303 WP_003094155.1.85311 WP_003094155.1.85318 WP_003094155.1.85357 WP_003094155.1.85446 WP_003094155.1.85453 WP_003094155.1.85574 WP_003094155.1.85633 WP_003094155.1.85638 WP_003094155.1.85788 WP_003094155.1.85897 WP_003094155.1.85910 WP_003094155.1.85920 WP_003094155.1.85978 WP_003094155.1.86002 WP_003094155.1.86047 WP_003094155.1.86055 WP_003094155.1.86058 WP_003094155.1.861 WP_003094155.1.86125 WP_003094155.1.86182 WP_003094155.1.86243 WP_003094155.1.86278 WP_003094155.1.86287 WP_003094155.1.86293 WP_003094155.1.86386 WP_003094155.1.86432 WP_003094155.1.8645 WP_003094155.1.865 WP_003094155.1.86506 WP_003094155.1.86545 WP_003094155.1.86552 WP_003094155.1.86554 WP_003094155.1.86595 WP_003094155.1.86652 WP_003094155.1.86665 WP_003094155.1.867 WP_003094155.1.86708 WP_003094155.1.86733 WP_003094155.1.86774 WP_003094155.1.86780 WP_003094155.1.86785 WP_003094155.1.86796 WP_003094155.1.86822 WP_003094155.1.8693 WP_003094155.1.86947 WP_003094155.1.86970 WP_003094155.1.86985 WP_003094155.1.87104 WP_003094155.1.87163 WP_003094155.1.8718 WP_003094155.1.87182 WP_003094155.1.8727 WP_003094155.1.87316 WP_003094155.1.87390 WP_003094155.1.87435 WP_003094155.1.87463 WP_003094155.1.8749 WP_003094155.1.87530 WP_003094155.1.87547 WP_003094155.1.87648 WP_003094155.1.87763 WP_003094155.1.8777 WP_003094155.1.8785 WP_003094155.1.87877 WP_003094155.1.87888 WP_003094155.1.87970 WP_003094155.1.87975 WP_003094155.1.87981 WP_003094155.1.87987 WP_003094155.1.88004 WP_003094155.1.88308 WP_003094155.1.88330 WP_003094155.1.88360 WP_003094155.1.88388 WP_003094155.1.88415 WP_003094155.1.88517 WP_003094155.1.8852 WP_003094155.1.88540 WP_003094155.1.88578 WP_003094155.1.88605 WP_003094155.1.88659 WP_003094155.1.88679 WP_003094155.1.88680 WP_003094155.1.88714 WP_003094155.1.88750 WP_003094155.1.88796 WP_003094155.1.889 WP_003094155.1.88900 WP_003094155.1.88949 WP_003094155.1.89083 WP_003094155.1.89098 WP_003094155.1.8911 WP_003094155.1.89234 WP_003094155.1.89245 WP_003094155.1.89266 WP_003094155.1.89276 WP_003094155.1.89330 WP_003094155.1.89409 WP_003094155.1.89434 WP_003094155.1.89440 WP_003094155.1.89480 WP_003094155.1.8949 WP_003094155.1.89491 WP_003094155.1.89577 WP_003094155.1.89610 WP_003094155.1.89638 WP_003094155.1.89662 WP_003094155.1.89669 WP_003094155.1.89736 WP_003094155.1.8976 WP_003094155.1.89776 WP_003094155.1.89805 WP_003094155.1.89866 WP_003094155.1.89867 WP_003094155.1.89868 WP_003094155.1.89871 WP_003094155.1.89886 WP_003094155.1.89992 WP_003094155.1.90024 WP_003094155.1.90032 WP_003094155.1.90056 WP_003094155.1.90110 WP_003094155.1.90141 WP_003094155.1.90150 WP_003094155.1.90189 WP_003094155.1.90224 WP_003094155.1.90225 WP_003094155.1.90242 WP_003094155.1.90268 WP_003094155.1.90272 WP_003094155.1.90306 WP_003094155.1.90412 WP_003094155.1.9056 WP_003094155.1.90569 WP_003094155.1.90655 WP_003094155.1.90770 WP_003094155.1.90940 WP_003094155.1.90999 WP_003094155.1.91012 WP_003094155.1.91093 WP_003094155.1.91161 WP_003094155.1.9120 WP_003094155.1.91204 WP_003094155.1.91236 WP_003094155.1.91281 WP_003094155.1.91307 WP_003094155.1.91336 WP_003094155.1.91360 WP_003094155.1.91392 WP_003094155.1.91416 WP_003094155.1.9143 WP_003094155.1.91431 WP_003094155.1.91438 WP_003094155.1.91467 WP_003094155.1.91527 WP_003094155.1.91563 WP_003094155.1.91585 WP_003094155.1.91796 WP_003094155.1.9182 WP_003094155.1.91838 WP_003094155.1.91846 WP_003094155.1.91860 WP_003094155.1.91862 WP_003094155.1.91882 WP_003094155.1.9191 WP_003094155.1.91938 WP_003094155.1.91943 WP_003094155.1.91996 WP_003094155.1.92043 WP_003094155.1.92175 WP_003094155.1.9219 WP_003094155.1.92314 WP_003094155.1.92321 WP_003094155.1.92357 WP_003094155.1.92573 WP_003094155.1.92585 WP_003094155.1.92587 WP_003094155.1.92589 WP_003094155.1.92594 WP_003094155.1.92624 WP_003094155.1.92630 WP_003094155.1.92642 WP_003094155.1.9272 WP_003094155.1.92759 WP_003094155.1.92769 WP_003094155.1.92839 WP_003094155.1.92847 WP_003094155.1.92894 WP_003094155.1.92924 WP_003094155.1.92930 WP_003094155.1.93001 WP_003094155.1.93090 WP_003094155.1.93122 WP_003094155.1.93130 WP_003094155.1.93144 WP_003094155.1.93196 WP_003094155.1.93250 WP_003094155.1.93264 WP_003094155.1.9328 WP_003094155.1.93446 WP_003094155.1.9349 WP_003094155.1.93493 WP_003094155.1.93498 WP_003094155.1.93520 WP_003094155.1.93547 WP_003094155.1.93562 WP_003094155.1.93568 WP_003094155.1.93797 WP_003094155.1.93848 WP_003094155.1.93889 WP_003094155.1.93897 WP_003094155.1.94004 WP_003094155.1.94031 WP_003094155.1.94065 WP_003094155.1.94078 WP_003094155.1.94136 WP_003094155.1.94174 WP_003094155.1.94211 WP_003094155.1.94218 WP_003094155.1.94221 WP_003094155.1.94230 WP_003094155.1.94243 WP_003094155.1.94285 WP_003094155.1.94288 WP_003094155.1.94333 WP_003094155.1.94349 WP_003094155.1.94385 WP_003094155.1.94434 WP_003094155.1.9444 WP_003094155.1.94682 WP_003094155.1.94732 WP_003094155.1.94742 WP_003094155.1.94814 WP_003094155.1.94818 WP_003094155.1.94856 WP_003094155.1.94874 WP_003094155.1.94881 WP_003094155.1.94896 WP_003094155.1.94897 WP_003094155.1.94943 WP_003094155.1.95018 WP_003094155.1.95025 WP_003094155.1.95027 WP_003094155.1.95056 WP_003094155.1.95117 WP_003094155.1.95132 WP_003094155.1.95187 WP_003094155.1.95207 WP_003094155.1.95217 WP_003094155.1.95305 WP_003094155.1.95324 WP_003094155.1.95354 WP_003094155.1.95359 WP_003094155.1.95460 WP_003094155.1.95488 WP_003094155.1.95525 WP_003094155.1.95536 WP_003094155.1.95638 WP_003094155.1.95668 WP_003094155.1.95745 WP_003094155.1.95751 WP_003094155.1.95774 WP_003094155.1.95782 WP_003094155.1.95787 WP_003094155.1.95802 WP_003094155.1.95820 WP_003094155.1.95825 WP_003094155.1.95959 WP_003094155.1.9599 WP_003094155.1.95994 WP_003094155.1.95999 WP_003094155.1.96008 WP_003094155.1.9604 WP_003094155.1.96041 WP_003094155.1.96058 WP_003094155.1.961 WP_003094155.1.96134 WP_003094155.1.96193 WP_003094155.1.96243 WP_003094155.1.96267 WP_003094155.1.96357 WP_003094155.1.96384 WP_003094155.1.96434 WP_003094155.1.96452 WP_003094155.1.96506 WP_003094155.1.96667 WP_003094155.1.96702 WP_003094155.1.96714 WP_003094155.1.96863 WP_003094155.1.96880 WP_003094155.1.96967 WP_003094155.1.9706 WP_003094155.1.97118 WP_003094155.1.97126 WP_003094155.1.97204 WP_003094155.1.97213 WP_003094155.1.9722 WP_003094155.1.97271 WP_003094155.1.97272 WP_003094155.1.97377 WP_003094155.1.97461 WP_003094155.1.97474 WP_003094155.1.97488 WP_003094155.1.97499 WP_003094155.1.97503 WP_003094155.1.97521 WP_003094155.1.97614 WP_003094155.1.977 WP_003094155.1.97784 WP_003094155.1.97826 WP_003094155.1.97877 WP_003094155.1.97968 WP_003094155.1.98111 WP_003094155.1.98260 WP_003094155.1.98276 WP_003094155.1.98308 WP_003094155.1.98410 WP_003094155.1.98414 WP_003094155.1.98433 WP_003094155.1.9845 WP_003094155.1.985 WP_003094155.1.98515 WP_003094155.1.98522 WP_003094155.1.98573 WP_003094155.1.98600 WP_003094155.1.98610 WP_003094155.1.98672 WP_003094155.1.98678 WP_003094155.1.98693 WP_003094155.1.98718 WP_003094155.1.98788 WP_003094155.1.98814 WP_003094155.1.9885 WP_003094155.1.98873 WP_003094155.1.98907 WP_003094155.1.98926 WP_003094155.1.98958 WP_003094155.1.98960 WP_003094155.1.98963 WP_003094155.1.99065 WP_003094155.1.99068 WP_003094155.1.99103 WP_003094155.1.99214 WP_003094155.1.99293 WP_003094155.1.99353 WP_003094155.1.99378 WP_003094155.1.99386 WP_003094155.1.99389 WP_003094155.1.99443 WP_003094155.1.99461 WP_003094155.1.9951 WP_003094155.1.99516 WP_003094155.1.99647 WP_003094155.1.99654 WP_003094155.1.99746 WP_003094155.1.99757 WP_003094155.1.99772 WP_003094155.1.99795 WP_003094155.1.99835 WP_003094155.1.9989 WP_003094155.1.99930 gi|514411581|ref|YP_008135063.1| gi|568311734|ref|YP_008984003.1| gi|478480742|ref|YP_007711393.1| gi|558674607|ref|YP_008811315.1| gi|116052461|ref|YP_792774.1| gi|568155944|ref|YP_008944936.1| 208963.PA14_57530 208964.PA4428 557722.PLES_48071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]