SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156028|ref|YP_008945020.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156028|ref|YP_008945020.1|
Domain Number 1 Region: 388-531
Classification Level Classification E-value
Superfamily Flavoproteins 8.17e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 707-850
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-36
Family NADPH-cytochrome p450 reductase-like 0.00054
Further Details:      
 
Domain Number 3 Region: 539-709
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.04e-24
Family Ferredoxin reductase FAD-binding domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156028|ref|YP_008945020.1|
Sequence length 850
Comment flavodoxin [Pseudomonas aeruginosa LES431]
Sequence
MKKVWFQLHWFFGISAGLVLALMGVTGATLSFQDELMRALNPDVLVVQKRSEGVLPLDEL
VRRIEGAEPGRKVAFVWVEMDSDKAGRIFYTPPPGQRRGESRWIDPYTGAFVGEPRGEGF
FNLMMQLHRFLAMGEYGKQVTAVCTLILIFFCLSGLYLRWPRKVFDWRAWLTLDWSRKGR
SFNWDLHAVAGTWCLALYLLAALTGLYWSYEWYRNGLFKLLDDAPAGQQAQRGKPGGRGE
RPADAAPLVVDYAAVWNSIRQAGGDRLQAYNLRLPPAGGQPATVFYRLTDAPHERAFNTL
TLDPANGQVKNDQRYSDRSFGSQLLASVYALHVGSYFGMAGRILMMLASLAMPLFFITGW
LLYLDRRRKKRAVRASRTDLGGSAGASGEPWLIGYASQSGFAEQLAWQSAGQLQAAGLPV
RVESLARLDAGQLAEARKALFVVSTFGDGEAPDSARGFERKVLGQAASLDGLSYALLALG
DRQYEQFCGFARRMQGWLQGQGARSLFAPVEVDDGDAAALRQWQESLAEVTGGAAPAAWE
APAFEVWSLARRECLNPGSQGESTWLLDLRAPTDSAIQWRAGDLLEIVPHQAPARIREWL
QRHNLDGQARVAVEGVEQSLEQALAGRLLPDSFEHLVGLHPQALLDALIPLSVRQYSIAS
LQSDGDLQLIVRQEQHADGSLGICSGWLTEYLPLGAALTLRLRRNAGFHLPEDDVPLILI
GNGTGLAGLRSLLRASIAAGRKRNWLLFGERNFAHDYYCRAELEQALARGELQRLDLAFS
RDQAEKIYVQDRLHEAADELRRWIDEGAALYVCGSLQGMAGGVDRVLREVLGEEALQRLA
DEGRYRRDVY
Download sequence
Identical sequences WP_012614535.1.10179 WP_012614535.1.10482 WP_012614535.1.11026 WP_012614535.1.11163 WP_012614535.1.11943 WP_012614535.1.12891 WP_012614535.1.13232 WP_012614535.1.1333 WP_012614535.1.14714 WP_012614535.1.1475 WP_012614535.1.19269 WP_012614535.1.21517 WP_012614535.1.22863 WP_012614535.1.23195 WP_012614535.1.23715 WP_012614535.1.24351 WP_012614535.1.25067 WP_012614535.1.251 WP_012614535.1.25142 WP_012614535.1.2535 WP_012614535.1.27575 WP_012614535.1.27837 WP_012614535.1.31279 WP_012614535.1.32544 WP_012614535.1.33210 WP_012614535.1.34832 WP_012614535.1.35857 WP_012614535.1.38102 WP_012614535.1.3833 WP_012614535.1.38502 WP_012614535.1.39088 WP_012614535.1.43662 WP_012614535.1.43667 WP_012614535.1.44959 WP_012614535.1.45090 WP_012614535.1.45485 WP_012614535.1.45934 WP_012614535.1.46152 WP_012614535.1.47774 WP_012614535.1.51136 WP_012614535.1.51501 WP_012614535.1.52244 WP_012614535.1.52690 WP_012614535.1.53719 WP_012614535.1.56797 WP_012614535.1.58689 WP_012614535.1.59076 WP_012614535.1.60415 WP_012614535.1.60603 WP_012614535.1.61696 WP_012614535.1.62516 WP_012614535.1.62534 WP_012614535.1.62701 WP_012614535.1.65099 WP_012614535.1.66526 WP_012614535.1.67388 WP_012614535.1.67686 WP_012614535.1.68568 WP_012614535.1.68862 WP_012614535.1.72331 WP_012614535.1.72772 WP_012614535.1.73149 WP_012614535.1.7547 WP_012614535.1.75825 WP_012614535.1.78430 WP_012614535.1.79544 WP_012614535.1.80033 WP_012614535.1.84374 WP_012614535.1.84589 WP_012614535.1.86545 WP_012614535.1.87435 WP_012614535.1.88388 WP_012614535.1.91431 WP_012614535.1.92769 WP_012614535.1.94385 WP_012614535.1.95802 WP_012614535.1.9722 WP_012614535.1.99461 WP_012614535.1.99757 gi|568156028|ref|YP_008945020.1| gi|218893605|ref|YP_002442474.1| 557722.PLES_48931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]