SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156134|ref|YP_008945126.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156134|ref|YP_008945126.1|
Domain Number 1 Region: 109-258
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-34
Family Reductases 0.00033
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.15e-21
Family Ferredoxin reductase FAD-binding domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568156134|ref|YP_008945126.1|
Sequence length 258
Comment ferredoxin--NADP reductase [Pseudomonas aeruginosa LES431]
Sequence
MTASEEKFTRQTLLDVQPLTPNLFTLRTSRDAGFRFRAGQFARLGVYKPSGSIVWRAYSM
VSAPHDEFLDFFSIVVPDGEFTSELSRLREGDQLLVDRQAFGFLTLDRFVDGRDLWLLAT
GTGVAPFVSILQDFEVWERFESIKLVYSVRESKELAYRELIAGLAEREYLAEHAHKLQFI
PVVTREQVPGCLNGRITTLIENGDLERAADLELTPEHSRVMLCGNPQMIEDTRAVLKARG
MNLSLTRRPGQVAVENYW
Download sequence
Identical sequences A0A072ZP46 A0A0E1B4U3 A0A0H2ZHI1 A0A0H3QWZ7 A0A157WFL9 A0A1C7B8Z0 A0A1E9C3E5 A0A1F0J8D2 A0A1G5JJS3 Q9HVH6
gi|15599811|ref|NP_253305.1| gi|558668444|ref|YP_008805154.1| 208963.PA14_61060 208964.PA4615 557722.PLES_50001 gi|564954926|ref|YP_008887496.1| gi|116052757|ref|YP_793074.1| gi|568156134|ref|YP_008945126.1| gi|514411757|ref|YP_008135252.1| gi|478481047|ref|YP_007711698.1| gi|392986281|ref|YP_006484868.1| gi|558674795|ref|YP_008811503.1| gi|218893712|ref|YP_002442581.1| NP_253305.1.87394 WP_003110878.1.100071 WP_003110878.1.100100 WP_003110878.1.100276 WP_003110878.1.100278 WP_003110878.1.100319 WP_003110878.1.100420 WP_003110878.1.100456 WP_003110878.1.100473 WP_003110878.1.100476 WP_003110878.1.100523 WP_003110878.1.100654 WP_003110878.1.100742 WP_003110878.1.100786 WP_003110878.1.100808 WP_003110878.1.100810 WP_003110878.1.100872 WP_003110878.1.100995 WP_003110878.1.101047 WP_003110878.1.101090 WP_003110878.1.101269 WP_003110878.1.101310 WP_003110878.1.101340 WP_003110878.1.101572 WP_003110878.1.101712 WP_003110878.1.101739 WP_003110878.1.10179 WP_003110878.1.101809 WP_003110878.1.10185 WP_003110878.1.101863 WP_003110878.1.10204 WP_003110878.1.102045 WP_003110878.1.10248 WP_003110878.1.1037 WP_003110878.1.10435 WP_003110878.1.10468 WP_003110878.1.10477 WP_003110878.1.10513 WP_003110878.1.10529 WP_003110878.1.10548 WP_003110878.1.10572 WP_003110878.1.10575 WP_003110878.1.10636 WP_003110878.1.10641 WP_003110878.1.10764 WP_003110878.1.10895 WP_003110878.1.10901 WP_003110878.1.11026 WP_003110878.1.11058 WP_003110878.1.11077 WP_003110878.1.1109 WP_003110878.1.11163 WP_003110878.1.11178 WP_003110878.1.11180 WP_003110878.1.11318 WP_003110878.1.11381 WP_003110878.1.11417 WP_003110878.1.11568 WP_003110878.1.11569 WP_003110878.1.11653 WP_003110878.1.11744 WP_003110878.1.1180 WP_003110878.1.11847 WP_003110878.1.11854 WP_003110878.1.1187 WP_003110878.1.11943 WP_003110878.1.12120 WP_003110878.1.12150 WP_003110878.1.12200 WP_003110878.1.12240 WP_003110878.1.12354 WP_003110878.1.1238 WP_003110878.1.12400 WP_003110878.1.12482 WP_003110878.1.12530 WP_003110878.1.12547 WP_003110878.1.12687 WP_003110878.1.12744 WP_003110878.1.12797 WP_003110878.1.12873 WP_003110878.1.12891 WP_003110878.1.12922 WP_003110878.1.12934 WP_003110878.1.12970 WP_003110878.1.12980 WP_003110878.1.13 WP_003110878.1.13041 WP_003110878.1.1305 WP_003110878.1.13085 WP_003110878.1.13232 WP_003110878.1.13315 WP_003110878.1.1333 WP_003110878.1.13529 WP_003110878.1.1356 WP_003110878.1.1362 WP_003110878.1.13622 WP_003110878.1.13718 WP_003110878.1.13743 WP_003110878.1.13765 WP_003110878.1.13785 WP_003110878.1.13795 WP_003110878.1.14078 WP_003110878.1.14096 WP_003110878.1.14251 WP_003110878.1.14378 WP_003110878.1.14424 WP_003110878.1.14455 WP_003110878.1.14460 WP_003110878.1.14476 WP_003110878.1.14564 WP_003110878.1.14714 WP_003110878.1.1475 WP_003110878.1.14754 WP_003110878.1.14797 WP_003110878.1.14815 WP_003110878.1.14820 WP_003110878.1.14883 WP_003110878.1.14981 WP_003110878.1.1516 WP_003110878.1.15222 WP_003110878.1.15231 WP_003110878.1.15281 WP_003110878.1.15379 WP_003110878.1.15474 WP_003110878.1.15485 WP_003110878.1.15606 WP_003110878.1.15692 WP_003110878.1.15886 WP_003110878.1.15889 WP_003110878.1.16041 WP_003110878.1.16109 WP_003110878.1.16197 WP_003110878.1.162 WP_003110878.1.16239 WP_003110878.1.16267 WP_003110878.1.16419 WP_003110878.1.1646 WP_003110878.1.16694 WP_003110878.1.1670 WP_003110878.1.1671 WP_003110878.1.16751 WP_003110878.1.16782 WP_003110878.1.16808 WP_003110878.1.16811 WP_003110878.1.16895 WP_003110878.1.17022 WP_003110878.1.1704 WP_003110878.1.17108 WP_003110878.1.17155 WP_003110878.1.17177 WP_003110878.1.172 WP_003110878.1.17223 WP_003110878.1.17353 WP_003110878.1.17354 WP_003110878.1.17370 WP_003110878.1.17566 WP_003110878.1.1761 WP_003110878.1.17883 WP_003110878.1.18117 WP_003110878.1.18156 WP_003110878.1.18157 WP_003110878.1.18199 WP_003110878.1.18204 WP_003110878.1.18234 WP_003110878.1.18349 WP_003110878.1.18440 WP_003110878.1.18493 WP_003110878.1.18508 WP_003110878.1.18547 WP_003110878.1.18653 WP_003110878.1.18728 WP_003110878.1.18735 WP_003110878.1.18769 WP_003110878.1.18892 WP_003110878.1.18907 WP_003110878.1.190 WP_003110878.1.19089 WP_003110878.1.19199 WP_003110878.1.19260 WP_003110878.1.19269 WP_003110878.1.19351 WP_003110878.1.19552 WP_003110878.1.19591 WP_003110878.1.19640 WP_003110878.1.19703 WP_003110878.1.1971 WP_003110878.1.19718 WP_003110878.1.19771 WP_003110878.1.19803 WP_003110878.1.19824 WP_003110878.1.20024 WP_003110878.1.20070 WP_003110878.1.2012 WP_003110878.1.20134 WP_003110878.1.20154 WP_003110878.1.20342 WP_003110878.1.20682 WP_003110878.1.20744 WP_003110878.1.20764 WP_003110878.1.20825 WP_003110878.1.20880 WP_003110878.1.20884 WP_003110878.1.20890 WP_003110878.1.209 WP_003110878.1.20978 WP_003110878.1.21039 WP_003110878.1.21096 WP_003110878.1.21242 WP_003110878.1.21253 WP_003110878.1.21349 WP_003110878.1.21358 WP_003110878.1.21448 WP_003110878.1.21469 WP_003110878.1.21517 WP_003110878.1.21607 WP_003110878.1.21718 WP_003110878.1.2172 WP_003110878.1.21767 WP_003110878.1.21782 WP_003110878.1.21863 WP_003110878.1.21871 WP_003110878.1.21891 WP_003110878.1.21932 WP_003110878.1.221 WP_003110878.1.22316 WP_003110878.1.22390 WP_003110878.1.22394 WP_003110878.1.22477 WP_003110878.1.22491 WP_003110878.1.22573 WP_003110878.1.22704 WP_003110878.1.22863 WP_003110878.1.2289 WP_003110878.1.22891 WP_003110878.1.23013 WP_003110878.1.23166 WP_003110878.1.23191 WP_003110878.1.23195 WP_003110878.1.23264 WP_003110878.1.23394 WP_003110878.1.23418 WP_003110878.1.23421 WP_003110878.1.23518 WP_003110878.1.23523 WP_003110878.1.23525 WP_003110878.1.2355 WP_003110878.1.23559 WP_003110878.1.23581 WP_003110878.1.23611 WP_003110878.1.23641 WP_003110878.1.23715 WP_003110878.1.23769 WP_003110878.1.23884 WP_003110878.1.23925 WP_003110878.1.23938 WP_003110878.1.23961 WP_003110878.1.23983 WP_003110878.1.24066 WP_003110878.1.24087 WP_003110878.1.24101 WP_003110878.1.24183 WP_003110878.1.24234 WP_003110878.1.24319 WP_003110878.1.24351 WP_003110878.1.24413 WP_003110878.1.2453 WP_003110878.1.24662 WP_003110878.1.2477 WP_003110878.1.24869 WP_003110878.1.24879 WP_003110878.1.24938 WP_003110878.1.25052 WP_003110878.1.25067 WP_003110878.1.25075 WP_003110878.1.251 WP_003110878.1.25109 WP_003110878.1.2511 WP_003110878.1.25142 WP_003110878.1.25149 WP_003110878.1.25179 WP_003110878.1.25191 WP_003110878.1.25271 WP_003110878.1.2529 WP_003110878.1.2530 WP_003110878.1.25348 WP_003110878.1.2535 WP_003110878.1.25477 WP_003110878.1.25532 WP_003110878.1.25675 WP_003110878.1.2572 WP_003110878.1.25834 WP_003110878.1.26025 WP_003110878.1.26042 WP_003110878.1.261 WP_003110878.1.26159 WP_003110878.1.26301 WP_003110878.1.26334 WP_003110878.1.26428 WP_003110878.1.26473 WP_003110878.1.26489 WP_003110878.1.2652 WP_003110878.1.26539 WP_003110878.1.26553 WP_003110878.1.26604 WP_003110878.1.26740 WP_003110878.1.26816 WP_003110878.1.26862 WP_003110878.1.26906 WP_003110878.1.27018 WP_003110878.1.27028 WP_003110878.1.27039 WP_003110878.1.27211 WP_003110878.1.27259 WP_003110878.1.27505 WP_003110878.1.27534 WP_003110878.1.27575 WP_003110878.1.27738 WP_003110878.1.27772 WP_003110878.1.27825 WP_003110878.1.27837 WP_003110878.1.27933 WP_003110878.1.28006 WP_003110878.1.28258 WP_003110878.1.28316 WP_003110878.1.28329 WP_003110878.1.28372 WP_003110878.1.28382 WP_003110878.1.28404 WP_003110878.1.28468 WP_003110878.1.28505 WP_003110878.1.28528 WP_003110878.1.28560 WP_003110878.1.28602 WP_003110878.1.28623 WP_003110878.1.28699 WP_003110878.1.28757 WP_003110878.1.28823 WP_003110878.1.28838 WP_003110878.1.28849 WP_003110878.1.29003 WP_003110878.1.29096 WP_003110878.1.29137 WP_003110878.1.29179 WP_003110878.1.29208 WP_003110878.1.2927 WP_003110878.1.29472 WP_003110878.1.2948 WP_003110878.1.29481 WP_003110878.1.29577 WP_003110878.1.2961 WP_003110878.1.29753 WP_003110878.1.29767 WP_003110878.1.2980 WP_003110878.1.29848 WP_003110878.1.29920 WP_003110878.1.29958 WP_003110878.1.30081 WP_003110878.1.30254 WP_003110878.1.30365 WP_003110878.1.30475 WP_003110878.1.30563 WP_003110878.1.30567 WP_003110878.1.30614 WP_003110878.1.30615 WP_003110878.1.30707 WP_003110878.1.3072 WP_003110878.1.30886 WP_003110878.1.30973 WP_003110878.1.30994 WP_003110878.1.31076 WP_003110878.1.31087 WP_003110878.1.31103 WP_003110878.1.31105 WP_003110878.1.31138 WP_003110878.1.31147 WP_003110878.1.31279 WP_003110878.1.31361 WP_003110878.1.31457 WP_003110878.1.31501 WP_003110878.1.31563 WP_003110878.1.31655 WP_003110878.1.3172 WP_003110878.1.31741 WP_003110878.1.3179 WP_003110878.1.31848 WP_003110878.1.31852 WP_003110878.1.3189 WP_003110878.1.319 WP_003110878.1.32314 WP_003110878.1.32359 WP_003110878.1.32447 WP_003110878.1.32544 WP_003110878.1.32596 WP_003110878.1.32641 WP_003110878.1.32821 WP_003110878.1.32869 WP_003110878.1.32879 WP_003110878.1.32998 WP_003110878.1.33047 WP_003110878.1.33133 WP_003110878.1.33152 WP_003110878.1.33186 WP_003110878.1.33204 WP_003110878.1.33210 WP_003110878.1.33216 WP_003110878.1.33294 WP_003110878.1.33340 WP_003110878.1.33387 WP_003110878.1.33438 WP_003110878.1.33455 WP_003110878.1.33523 WP_003110878.1.33547 WP_003110878.1.33549 WP_003110878.1.33653 WP_003110878.1.33658 WP_003110878.1.33669 WP_003110878.1.3368 WP_003110878.1.33733 WP_003110878.1.33734 WP_003110878.1.3376 WP_003110878.1.33774 WP_003110878.1.33814 WP_003110878.1.33833 WP_003110878.1.34000 WP_003110878.1.34039 WP_003110878.1.34136 WP_003110878.1.34143 WP_003110878.1.34151 WP_003110878.1.34180 WP_003110878.1.34191 WP_003110878.1.34317 WP_003110878.1.3436 WP_003110878.1.34401 WP_003110878.1.34402 WP_003110878.1.34461 WP_003110878.1.34472 WP_003110878.1.34556 WP_003110878.1.34784 WP_003110878.1.34821 WP_003110878.1.34832 WP_003110878.1.34836 WP_003110878.1.34837 WP_003110878.1.34878 WP_003110878.1.35036 WP_003110878.1.35104 WP_003110878.1.35149 WP_003110878.1.35231 WP_003110878.1.3531 WP_003110878.1.35442 WP_003110878.1.35480 WP_003110878.1.35573 WP_003110878.1.35599 WP_003110878.1.35639 WP_003110878.1.35669 WP_003110878.1.35679 WP_003110878.1.35682 WP_003110878.1.3576 WP_003110878.1.35762 WP_003110878.1.35768 WP_003110878.1.35857 WP_003110878.1.35872 WP_003110878.1.35968 WP_003110878.1.35984 WP_003110878.1.36064 WP_003110878.1.36121 WP_003110878.1.36148 WP_003110878.1.36170 WP_003110878.1.36266 WP_003110878.1.36267 WP_003110878.1.36378 WP_003110878.1.36521 WP_003110878.1.3653 WP_003110878.1.36587 WP_003110878.1.36608 WP_003110878.1.36665 WP_003110878.1.36756 WP_003110878.1.36879 WP_003110878.1.37097 WP_003110878.1.37125 WP_003110878.1.37163 WP_003110878.1.37172 WP_003110878.1.37208 WP_003110878.1.3721 WP_003110878.1.373 WP_003110878.1.37319 WP_003110878.1.37500 WP_003110878.1.37571 WP_003110878.1.3768 WP_003110878.1.37703 WP_003110878.1.37799 WP_003110878.1.37814 WP_003110878.1.37826 WP_003110878.1.37842 WP_003110878.1.3792 WP_003110878.1.38023 WP_003110878.1.38060 WP_003110878.1.38102 WP_003110878.1.38146 WP_003110878.1.38151 WP_003110878.1.3818 WP_003110878.1.38186 WP_003110878.1.3821 WP_003110878.1.38319 WP_003110878.1.3833 WP_003110878.1.38430 WP_003110878.1.38502 WP_003110878.1.38505 WP_003110878.1.38510 WP_003110878.1.38583 WP_003110878.1.38587 WP_003110878.1.38657 WP_003110878.1.38661 WP_003110878.1.38706 WP_003110878.1.38816 WP_003110878.1.3887 WP_003110878.1.38889 WP_003110878.1.39046 WP_003110878.1.39088 WP_003110878.1.39186 WP_003110878.1.39271 WP_003110878.1.39326 WP_003110878.1.39345 WP_003110878.1.39444 WP_003110878.1.39452 WP_003110878.1.39458 WP_003110878.1.39537 WP_003110878.1.39704 WP_003110878.1.39765 WP_003110878.1.39786 WP_003110878.1.39811 WP_003110878.1.39989 WP_003110878.1.40115 WP_003110878.1.40135 WP_003110878.1.40207 WP_003110878.1.40213 WP_003110878.1.40243 WP_003110878.1.4038 WP_003110878.1.40419 WP_003110878.1.40442 WP_003110878.1.40512 WP_003110878.1.40546 WP_003110878.1.4058 WP_003110878.1.40874 WP_003110878.1.40984 WP_003110878.1.40993 WP_003110878.1.40994 WP_003110878.1.41110 WP_003110878.1.41290 WP_003110878.1.41301 WP_003110878.1.41429 WP_003110878.1.41487 WP_003110878.1.41725 WP_003110878.1.41732 WP_003110878.1.41773 WP_003110878.1.41832 WP_003110878.1.41846 WP_003110878.1.41871 WP_003110878.1.41888 WP_003110878.1.4190 WP_003110878.1.4196 WP_003110878.1.42 WP_003110878.1.42047 WP_003110878.1.42146 WP_003110878.1.42259 WP_003110878.1.42294 WP_003110878.1.42316 WP_003110878.1.42381 WP_003110878.1.42411 WP_003110878.1.42423 WP_003110878.1.42463 WP_003110878.1.42499 WP_003110878.1.42508 WP_003110878.1.42634 WP_003110878.1.42643 WP_003110878.1.42757 WP_003110878.1.42778 WP_003110878.1.42789 WP_003110878.1.42854 WP_003110878.1.42870 WP_003110878.1.42917 WP_003110878.1.42952 WP_003110878.1.42972 WP_003110878.1.43022 WP_003110878.1.43024 WP_003110878.1.43049 WP_003110878.1.43245 WP_003110878.1.43286 WP_003110878.1.43293 WP_003110878.1.43315 WP_003110878.1.43356 WP_003110878.1.4348 WP_003110878.1.43593 WP_003110878.1.43662 WP_003110878.1.43667 WP_003110878.1.43696 WP_003110878.1.43729 WP_003110878.1.43756 WP_003110878.1.43783 WP_003110878.1.43802 WP_003110878.1.4381 WP_003110878.1.43826 WP_003110878.1.4397 WP_003110878.1.4398 WP_003110878.1.43998 WP_003110878.1.44046 WP_003110878.1.44094 WP_003110878.1.44260 WP_003110878.1.44486 WP_003110878.1.445 WP_003110878.1.44565 WP_003110878.1.44581 WP_003110878.1.44725 WP_003110878.1.44739 WP_003110878.1.44760 WP_003110878.1.44959 WP_003110878.1.45063 WP_003110878.1.45090 WP_003110878.1.45146 WP_003110878.1.45202 WP_003110878.1.4522 WP_003110878.1.45298 WP_003110878.1.45306 WP_003110878.1.45328 WP_003110878.1.45353 WP_003110878.1.45358 WP_003110878.1.45464 WP_003110878.1.45478 WP_003110878.1.45485 WP_003110878.1.45604 WP_003110878.1.45635 WP_003110878.1.45636 WP_003110878.1.45678 WP_003110878.1.45700 WP_003110878.1.45711 WP_003110878.1.45723 WP_003110878.1.45818 WP_003110878.1.45837 WP_003110878.1.45920 WP_003110878.1.45934 WP_003110878.1.46032 WP_003110878.1.46093 WP_003110878.1.461 WP_003110878.1.46152 WP_003110878.1.46306 WP_003110878.1.46502 WP_003110878.1.46755 WP_003110878.1.46826 WP_003110878.1.46866 WP_003110878.1.46885 WP_003110878.1.46926 WP_003110878.1.47101 WP_003110878.1.4726 WP_003110878.1.47314 WP_003110878.1.47374 WP_003110878.1.47469 WP_003110878.1.47480 WP_003110878.1.47527 WP_003110878.1.47774 WP_003110878.1.47930 WP_003110878.1.47934 WP_003110878.1.47970 WP_003110878.1.48001 WP_003110878.1.48024 WP_003110878.1.48086 WP_003110878.1.48141 WP_003110878.1.48172 WP_003110878.1.48178 WP_003110878.1.4836 WP_003110878.1.48378 WP_003110878.1.48382 WP_003110878.1.48413 WP_003110878.1.48472 WP_003110878.1.48474 WP_003110878.1.48487 WP_003110878.1.48545 WP_003110878.1.48546 WP_003110878.1.48747 WP_003110878.1.48820 WP_003110878.1.48842 WP_003110878.1.48851 WP_003110878.1.48961 WP_003110878.1.49108 WP_003110878.1.4913 WP_003110878.1.49135 WP_003110878.1.49184 WP_003110878.1.49244 WP_003110878.1.49265 WP_003110878.1.49266 WP_003110878.1.49286 WP_003110878.1.49293 WP_003110878.1.49360 WP_003110878.1.49416 WP_003110878.1.49500 WP_003110878.1.49557 WP_003110878.1.49566 WP_003110878.1.49688 WP_003110878.1.49798 WP_003110878.1.49806 WP_003110878.1.49833 WP_003110878.1.49842 WP_003110878.1.49948 WP_003110878.1.49976 WP_003110878.1.49988 WP_003110878.1.49998 WP_003110878.1.50176 WP_003110878.1.50180 WP_003110878.1.50222 WP_003110878.1.5043 WP_003110878.1.50653 WP_003110878.1.50691 WP_003110878.1.50734 WP_003110878.1.50922 WP_003110878.1.50967 WP_003110878.1.50989 WP_003110878.1.51019 WP_003110878.1.51136 WP_003110878.1.51141 WP_003110878.1.51173 WP_003110878.1.51185 WP_003110878.1.51538 WP_003110878.1.51585 WP_003110878.1.51727 WP_003110878.1.51733 WP_003110878.1.51807 WP_003110878.1.51847 WP_003110878.1.51889 WP_003110878.1.51917 WP_003110878.1.51928 WP_003110878.1.51943 WP_003110878.1.51957 WP_003110878.1.51976 WP_003110878.1.52212 WP_003110878.1.52220 WP_003110878.1.52244 WP_003110878.1.5226 WP_003110878.1.52326 WP_003110878.1.52334 WP_003110878.1.52355 WP_003110878.1.52409 WP_003110878.1.52500 WP_003110878.1.52537 WP_003110878.1.5258 WP_003110878.1.52583 WP_003110878.1.5260 WP_003110878.1.52690 WP_003110878.1.52700 WP_003110878.1.52728 WP_003110878.1.52784 WP_003110878.1.52790 WP_003110878.1.52850 WP_003110878.1.53037 WP_003110878.1.53038 WP_003110878.1.53070 WP_003110878.1.53072 WP_003110878.1.53287 WP_003110878.1.53351 WP_003110878.1.53371 WP_003110878.1.53414 WP_003110878.1.53528 WP_003110878.1.53530 WP_003110878.1.53663 WP_003110878.1.53719 WP_003110878.1.53726 WP_003110878.1.5388 WP_003110878.1.53932 WP_003110878.1.53948 WP_003110878.1.5399 WP_003110878.1.54090 WP_003110878.1.54133 WP_003110878.1.54146 WP_003110878.1.5420 WP_003110878.1.5427 WP_003110878.1.54293 WP_003110878.1.54354 WP_003110878.1.54462 WP_003110878.1.54497 WP_003110878.1.54809 WP_003110878.1.54974 WP_003110878.1.55089 WP_003110878.1.55169 WP_003110878.1.55347 WP_003110878.1.55387 WP_003110878.1.55400 WP_003110878.1.55543 WP_003110878.1.55729 WP_003110878.1.55813 WP_003110878.1.55976 WP_003110878.1.56013 WP_003110878.1.56037 WP_003110878.1.56187 WP_003110878.1.56196 WP_003110878.1.56228 WP_003110878.1.56229 WP_003110878.1.56315 WP_003110878.1.56442 WP_003110878.1.56465 WP_003110878.1.56474 WP_003110878.1.56475 WP_003110878.1.56623 WP_003110878.1.56626 WP_003110878.1.56632 WP_003110878.1.56745 WP_003110878.1.56797 WP_003110878.1.56819 WP_003110878.1.56837 WP_003110878.1.56896 WP_003110878.1.56973 WP_003110878.1.57020 WP_003110878.1.57113 WP_003110878.1.57276 WP_003110878.1.57339 WP_003110878.1.57369 WP_003110878.1.57417 WP_003110878.1.57532 WP_003110878.1.57548 WP_003110878.1.57566 WP_003110878.1.57728 WP_003110878.1.57792 WP_003110878.1.57841 WP_003110878.1.57853 WP_003110878.1.57966 WP_003110878.1.58183 WP_003110878.1.58193 WP_003110878.1.58200 WP_003110878.1.58228 WP_003110878.1.58360 WP_003110878.1.58417 WP_003110878.1.58436 WP_003110878.1.5850 WP_003110878.1.58510 WP_003110878.1.58527 WP_003110878.1.5856 WP_003110878.1.58689 WP_003110878.1.58800 WP_003110878.1.5889 WP_003110878.1.58944 WP_003110878.1.58952 WP_003110878.1.59013 WP_003110878.1.59076 WP_003110878.1.59099 WP_003110878.1.59123 WP_003110878.1.59156 WP_003110878.1.59158 WP_003110878.1.59176 WP_003110878.1.59212 WP_003110878.1.59246 WP_003110878.1.59249 WP_003110878.1.59288 WP_003110878.1.59376 WP_003110878.1.59724 WP_003110878.1.59797 WP_003110878.1.59831 WP_003110878.1.60051 WP_003110878.1.60084 WP_003110878.1.60206 WP_003110878.1.60261 WP_003110878.1.60347 WP_003110878.1.60364 WP_003110878.1.60396 WP_003110878.1.60415 WP_003110878.1.60467 WP_003110878.1.60472 WP_003110878.1.60509 WP_003110878.1.60602 WP_003110878.1.60603 WP_003110878.1.60679 WP_003110878.1.60686 WP_003110878.1.60916 WP_003110878.1.60970 WP_003110878.1.61130 WP_003110878.1.61209 WP_003110878.1.61222 WP_003110878.1.61269 WP_003110878.1.61288 WP_003110878.1.61294 WP_003110878.1.6130 WP_003110878.1.61431 WP_003110878.1.61493 WP_003110878.1.61549 WP_003110878.1.61589 WP_003110878.1.61598 WP_003110878.1.61696 WP_003110878.1.61943 WP_003110878.1.62010 WP_003110878.1.62035 WP_003110878.1.62180 WP_003110878.1.62263 WP_003110878.1.62357 WP_003110878.1.62410 WP_003110878.1.6242 WP_003110878.1.62483 WP_003110878.1.62516 WP_003110878.1.62534 WP_003110878.1.62604 WP_003110878.1.62635 WP_003110878.1.62701 WP_003110878.1.62703 WP_003110878.1.62708 WP_003110878.1.62768 WP_003110878.1.62772 WP_003110878.1.6283 WP_003110878.1.62838 WP_003110878.1.62873 WP_003110878.1.62977 WP_003110878.1.63038 WP_003110878.1.63041 WP_003110878.1.63057 WP_003110878.1.63124 WP_003110878.1.63193 WP_003110878.1.63196 WP_003110878.1.63401 WP_003110878.1.63591 WP_003110878.1.63597 WP_003110878.1.63634 WP_003110878.1.63659 WP_003110878.1.63739 WP_003110878.1.63784 WP_003110878.1.64139 WP_003110878.1.64212 WP_003110878.1.64329 WP_003110878.1.64340 WP_003110878.1.64433 WP_003110878.1.6450 WP_003110878.1.64544 WP_003110878.1.64603 WP_003110878.1.6461 WP_003110878.1.64726 WP_003110878.1.64748 WP_003110878.1.64807 WP_003110878.1.64854 WP_003110878.1.64862 WP_003110878.1.64880 WP_003110878.1.64885 WP_003110878.1.64886 WP_003110878.1.64983 WP_003110878.1.64984 WP_003110878.1.65066 WP_003110878.1.65095 WP_003110878.1.65099 WP_003110878.1.65145 WP_003110878.1.65237 WP_003110878.1.65247 WP_003110878.1.65285 WP_003110878.1.65312 WP_003110878.1.65316 WP_003110878.1.65334 WP_003110878.1.65335 WP_003110878.1.65457 WP_003110878.1.65632 WP_003110878.1.65642 WP_003110878.1.65740 WP_003110878.1.65779 WP_003110878.1.65819 WP_003110878.1.65867 WP_003110878.1.6589 WP_003110878.1.65926 WP_003110878.1.66155 WP_003110878.1.66165 WP_003110878.1.66526 WP_003110878.1.66634 WP_003110878.1.66721 WP_003110878.1.66892 WP_003110878.1.66929 WP_003110878.1.66931 WP_003110878.1.66945 WP_003110878.1.66950 WP_003110878.1.66982 WP_003110878.1.67188 WP_003110878.1.67205 WP_003110878.1.67261 WP_003110878.1.67269 WP_003110878.1.67370 WP_003110878.1.67388 WP_003110878.1.67472 WP_003110878.1.67506 WP_003110878.1.67526 WP_003110878.1.67531 WP_003110878.1.67545 WP_003110878.1.6768 WP_003110878.1.67686 WP_003110878.1.67755 WP_003110878.1.67830 WP_003110878.1.67875 WP_003110878.1.67899 WP_003110878.1.67903 WP_003110878.1.67937 WP_003110878.1.67948 WP_003110878.1.68158 WP_003110878.1.68162 WP_003110878.1.68172 WP_003110878.1.68194 WP_003110878.1.68252 WP_003110878.1.68317 WP_003110878.1.68472 WP_003110878.1.68499 WP_003110878.1.68568 WP_003110878.1.68638 WP_003110878.1.6866 WP_003110878.1.68756 WP_003110878.1.68781 WP_003110878.1.68800 WP_003110878.1.68802 WP_003110878.1.68850 WP_003110878.1.68857 WP_003110878.1.68862 WP_003110878.1.68938 WP_003110878.1.68979 WP_003110878.1.69159 WP_003110878.1.69209 WP_003110878.1.69260 WP_003110878.1.69330 WP_003110878.1.69411 WP_003110878.1.69534 WP_003110878.1.69702 WP_003110878.1.69819 WP_003110878.1.69834 WP_003110878.1.69907 WP_003110878.1.69993 WP_003110878.1.70092 WP_003110878.1.70098 WP_003110878.1.70138 WP_003110878.1.70168 WP_003110878.1.70194 WP_003110878.1.70216 WP_003110878.1.70229 WP_003110878.1.70470 WP_003110878.1.70537 WP_003110878.1.70583 WP_003110878.1.70670 WP_003110878.1.70677 WP_003110878.1.7077 WP_003110878.1.70778 WP_003110878.1.71038 WP_003110878.1.71141 WP_003110878.1.71203 WP_003110878.1.71234 WP_003110878.1.71249 WP_003110878.1.7128 WP_003110878.1.71346 WP_003110878.1.71385 WP_003110878.1.71570 WP_003110878.1.7163 WP_003110878.1.71642 WP_003110878.1.71738 WP_003110878.1.71799 WP_003110878.1.71806 WP_003110878.1.71862 WP_003110878.1.71866 WP_003110878.1.71927 WP_003110878.1.71934 WP_003110878.1.72167 WP_003110878.1.72181 WP_003110878.1.72287 WP_003110878.1.72331 WP_003110878.1.72477 WP_003110878.1.72541 WP_003110878.1.72562 WP_003110878.1.72570 WP_003110878.1.72653 WP_003110878.1.72727 WP_003110878.1.72768 WP_003110878.1.72845 WP_003110878.1.72920 WP_003110878.1.73048 WP_003110878.1.73135 WP_003110878.1.73149 WP_003110878.1.73172 WP_003110878.1.73192 WP_003110878.1.7327 WP_003110878.1.733 WP_003110878.1.73455 WP_003110878.1.73523 WP_003110878.1.73541 WP_003110878.1.73601 WP_003110878.1.73651 WP_003110878.1.73719 WP_003110878.1.73728 WP_003110878.1.7377 WP_003110878.1.7382 WP_003110878.1.73860 WP_003110878.1.73941 WP_003110878.1.74 WP_003110878.1.74072 WP_003110878.1.74074 WP_003110878.1.74106 WP_003110878.1.74219 WP_003110878.1.74268 WP_003110878.1.74281 WP_003110878.1.74326 WP_003110878.1.74458 WP_003110878.1.74473 WP_003110878.1.74475 WP_003110878.1.7448 WP_003110878.1.7456 WP_003110878.1.74568 WP_003110878.1.74604 WP_003110878.1.74685 WP_003110878.1.74776 WP_003110878.1.748 WP_003110878.1.75041 WP_003110878.1.75204 WP_003110878.1.75277 WP_003110878.1.75431 WP_003110878.1.7547 WP_003110878.1.75549 WP_003110878.1.75573 WP_003110878.1.75580 WP_003110878.1.75599 WP_003110878.1.75603 WP_003110878.1.75631 WP_003110878.1.75771 WP_003110878.1.75825 WP_003110878.1.75826 WP_003110878.1.75935 WP_003110878.1.75947 WP_003110878.1.7595 WP_003110878.1.76077 WP_003110878.1.76092 WP_003110878.1.76141 WP_003110878.1.76145 WP_003110878.1.76192 WP_003110878.1.76322 WP_003110878.1.76355 WP_003110878.1.76383 WP_003110878.1.76399 WP_003110878.1.76441 WP_003110878.1.76543 WP_003110878.1.76600 WP_003110878.1.76716 WP_003110878.1.76775 WP_003110878.1.76791 WP_003110878.1.77235 WP_003110878.1.77286 WP_003110878.1.77317 WP_003110878.1.77476 WP_003110878.1.77490 WP_003110878.1.77566 WP_003110878.1.77587 WP_003110878.1.7779 WP_003110878.1.77819 WP_003110878.1.77834 WP_003110878.1.77913 WP_003110878.1.78112 WP_003110878.1.78118 WP_003110878.1.78134 WP_003110878.1.78148 WP_003110878.1.78158 WP_003110878.1.78280 WP_003110878.1.78288 WP_003110878.1.78380 WP_003110878.1.7840 WP_003110878.1.78425 WP_003110878.1.78430 WP_003110878.1.78437 WP_003110878.1.78570 WP_003110878.1.78623 WP_003110878.1.78669 WP_003110878.1.78795 WP_003110878.1.788 WP_003110878.1.78810 WP_003110878.1.78954 WP_003110878.1.78986 WP_003110878.1.7899 WP_003110878.1.79007 WP_003110878.1.79256 WP_003110878.1.79279 WP_003110878.1.79311 WP_003110878.1.79364 WP_003110878.1.79421 WP_003110878.1.79429 WP_003110878.1.79507 WP_003110878.1.7953 WP_003110878.1.79544 WP_003110878.1.79569 WP_003110878.1.79631 WP_003110878.1.79699 WP_003110878.1.79754 WP_003110878.1.79788 WP_003110878.1.799 WP_003110878.1.79902 WP_003110878.1.79908 WP_003110878.1.79986 WP_003110878.1.80068 WP_003110878.1.80102 WP_003110878.1.80174 WP_003110878.1.8028 WP_003110878.1.80306 WP_003110878.1.8038 WP_003110878.1.80410 WP_003110878.1.80454 WP_003110878.1.80481 WP_003110878.1.8051 WP_003110878.1.80572 WP_003110878.1.80627 WP_003110878.1.8064 WP_003110878.1.80683 WP_003110878.1.80785 WP_003110878.1.80846 WP_003110878.1.80880 WP_003110878.1.80910 WP_003110878.1.80931 WP_003110878.1.80938 WP_003110878.1.80969 WP_003110878.1.81082 WP_003110878.1.81206 WP_003110878.1.81237 WP_003110878.1.81331 WP_003110878.1.81368 WP_003110878.1.81380 WP_003110878.1.81426 WP_003110878.1.81470 WP_003110878.1.81581 WP_003110878.1.81622 WP_003110878.1.81643 WP_003110878.1.81742 WP_003110878.1.81771 WP_003110878.1.81784 WP_003110878.1.81834 WP_003110878.1.81844 WP_003110878.1.81856 WP_003110878.1.81874 WP_003110878.1.81927 WP_003110878.1.81950 WP_003110878.1.81957 WP_003110878.1.81960 WP_003110878.1.82328 WP_003110878.1.82334 WP_003110878.1.8238 WP_003110878.1.82604 WP_003110878.1.82620 WP_003110878.1.82643 WP_003110878.1.82686 WP_003110878.1.82710 WP_003110878.1.8284 WP_003110878.1.82864 WP_003110878.1.82882 WP_003110878.1.83131 WP_003110878.1.83184 WP_003110878.1.83251 WP_003110878.1.83296 WP_003110878.1.83317 WP_003110878.1.83374 WP_003110878.1.83394 WP_003110878.1.83440 WP_003110878.1.83460 WP_003110878.1.835 WP_003110878.1.83503 WP_003110878.1.83534 WP_003110878.1.83540 WP_003110878.1.83637 WP_003110878.1.83673 WP_003110878.1.83698 WP_003110878.1.83946 WP_003110878.1.84003 WP_003110878.1.84008 WP_003110878.1.84138 WP_003110878.1.84174 WP_003110878.1.84177 WP_003110878.1.84178 WP_003110878.1.84190 WP_003110878.1.84203 WP_003110878.1.84297 WP_003110878.1.8437 WP_003110878.1.84374 WP_003110878.1.84404 WP_003110878.1.84471 WP_003110878.1.84487 WP_003110878.1.8453 WP_003110878.1.84538 WP_003110878.1.84558 WP_003110878.1.84674 WP_003110878.1.84702 WP_003110878.1.84715 WP_003110878.1.84754 WP_003110878.1.84792 WP_003110878.1.8484 WP_003110878.1.84865 WP_003110878.1.84937 WP_003110878.1.84946 WP_003110878.1.8498 WP_003110878.1.85018 WP_003110878.1.85059 WP_003110878.1.85150 WP_003110878.1.85290 WP_003110878.1.85311 WP_003110878.1.85318 WP_003110878.1.85574 WP_003110878.1.85633 WP_003110878.1.85638 WP_003110878.1.85897 WP_003110878.1.85910 WP_003110878.1.85920 WP_003110878.1.86047 WP_003110878.1.861 WP_003110878.1.86278 WP_003110878.1.86287 WP_003110878.1.86293 WP_003110878.1.86432 WP_003110878.1.86545 WP_003110878.1.86552 WP_003110878.1.86652 WP_003110878.1.86665 WP_003110878.1.86708 WP_003110878.1.86733 WP_003110878.1.86785 WP_003110878.1.86796 WP_003110878.1.86822 WP_003110878.1.8693 WP_003110878.1.86970 WP_003110878.1.86985 WP_003110878.1.87104 WP_003110878.1.87163 WP_003110878.1.8718 WP_003110878.1.87435 WP_003110878.1.8749 WP_003110878.1.87530 WP_003110878.1.87547 WP_003110878.1.87648 WP_003110878.1.87763 WP_003110878.1.8777 WP_003110878.1.8785 WP_003110878.1.87888 WP_003110878.1.87970 WP_003110878.1.88308 WP_003110878.1.88330 WP_003110878.1.88388 WP_003110878.1.88540 WP_003110878.1.88714 WP_003110878.1.88750 WP_003110878.1.88796 WP_003110878.1.88900 WP_003110878.1.88949 WP_003110878.1.89098 WP_003110878.1.8911 WP_003110878.1.89234 WP_003110878.1.89266 WP_003110878.1.89276 WP_003110878.1.89330 WP_003110878.1.89409 WP_003110878.1.89434 WP_003110878.1.89440 WP_003110878.1.89480 WP_003110878.1.8949 WP_003110878.1.89491 WP_003110878.1.89523 WP_003110878.1.89577 WP_003110878.1.89638 WP_003110878.1.89662 WP_003110878.1.89669 WP_003110878.1.89736 WP_003110878.1.8976 WP_003110878.1.89805 WP_003110878.1.89866 WP_003110878.1.89868 WP_003110878.1.89871 WP_003110878.1.89992 WP_003110878.1.90024 WP_003110878.1.90032 WP_003110878.1.90056 WP_003110878.1.90150 WP_003110878.1.90224 WP_003110878.1.90242 WP_003110878.1.90306 WP_003110878.1.90412 WP_003110878.1.9056 WP_003110878.1.90569 WP_003110878.1.91161 WP_003110878.1.9120 WP_003110878.1.91204 WP_003110878.1.91307 WP_003110878.1.91360 WP_003110878.1.91392 WP_003110878.1.91416 WP_003110878.1.9143 WP_003110878.1.91431 WP_003110878.1.91438 WP_003110878.1.91527 WP_003110878.1.9182 WP_003110878.1.91846 WP_003110878.1.91860 WP_003110878.1.91862 WP_003110878.1.9191 WP_003110878.1.91938 WP_003110878.1.91943 WP_003110878.1.91996 WP_003110878.1.92043 WP_003110878.1.92175 WP_003110878.1.92314 WP_003110878.1.92321 WP_003110878.1.92357 WP_003110878.1.92573 WP_003110878.1.92585 WP_003110878.1.92589 WP_003110878.1.92594 WP_003110878.1.92624 WP_003110878.1.92630 WP_003110878.1.9272 WP_003110878.1.92759 WP_003110878.1.92769 WP_003110878.1.92839 WP_003110878.1.93090 WP_003110878.1.93122 WP_003110878.1.93130 WP_003110878.1.93144 WP_003110878.1.93250 WP_003110878.1.93264 WP_003110878.1.9328 WP_003110878.1.93446 WP_003110878.1.9349 WP_003110878.1.93493 WP_003110878.1.93568 WP_003110878.1.93848 WP_003110878.1.93889 WP_003110878.1.93897 WP_003110878.1.94004 WP_003110878.1.94078 WP_003110878.1.94174 WP_003110878.1.94221 WP_003110878.1.94230 WP_003110878.1.94243 WP_003110878.1.94285 WP_003110878.1.94333 WP_003110878.1.94349 WP_003110878.1.94385 WP_003110878.1.94434 WP_003110878.1.9444 WP_003110878.1.94450 WP_003110878.1.94682 WP_003110878.1.94732 WP_003110878.1.94814 WP_003110878.1.94818 WP_003110878.1.94896 WP_003110878.1.94943 WP_003110878.1.95018 WP_003110878.1.95025 WP_003110878.1.95027 WP_003110878.1.95056 WP_003110878.1.95117 WP_003110878.1.95132 WP_003110878.1.95187 WP_003110878.1.95207 WP_003110878.1.95217 WP_003110878.1.95305 WP_003110878.1.95324 WP_003110878.1.95354 WP_003110878.1.95460 WP_003110878.1.95488 WP_003110878.1.95525 WP_003110878.1.95774 WP_003110878.1.95782 WP_003110878.1.95787 WP_003110878.1.95802 WP_003110878.1.95820 WP_003110878.1.95825 WP_003110878.1.95959 WP_003110878.1.9599 WP_003110878.1.95994 WP_003110878.1.95999 WP_003110878.1.96008 WP_003110878.1.9604 WP_003110878.1.96058 WP_003110878.1.961 WP_003110878.1.96134 WP_003110878.1.96243 WP_003110878.1.96267 WP_003110878.1.96357 WP_003110878.1.96434 WP_003110878.1.96506 WP_003110878.1.96667 WP_003110878.1.96880 WP_003110878.1.96967 WP_003110878.1.9706 WP_003110878.1.97118 WP_003110878.1.97126 WP_003110878.1.97213 WP_003110878.1.9722 WP_003110878.1.97272 WP_003110878.1.97377 WP_003110878.1.97461 WP_003110878.1.97474 WP_003110878.1.97488 WP_003110878.1.97499 WP_003110878.1.97521 WP_003110878.1.97583 WP_003110878.1.97614 WP_003110878.1.97968 WP_003110878.1.98111 WP_003110878.1.98260 WP_003110878.1.98308 WP_003110878.1.98410 WP_003110878.1.98414 WP_003110878.1.98433 WP_003110878.1.9845 WP_003110878.1.985 WP_003110878.1.98573 WP_003110878.1.98600 WP_003110878.1.98610 WP_003110878.1.98678 WP_003110878.1.98693 WP_003110878.1.98718 WP_003110878.1.98788 WP_003110878.1.9885 WP_003110878.1.98873 WP_003110878.1.98907 WP_003110878.1.98958 WP_003110878.1.98960 WP_003110878.1.98963 WP_003110878.1.99065 WP_003110878.1.99103 WP_003110878.1.99214 WP_003110878.1.99293 WP_003110878.1.99353 WP_003110878.1.99378 WP_003110878.1.99443 WP_003110878.1.9951 WP_003110878.1.99654 WP_003110878.1.99662 WP_003110878.1.99746 WP_003110878.1.99757 WP_003110878.1.99772 WP_003110878.1.99795 WP_003110878.1.99835 WP_003110878.1.99930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]