SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156414|ref|YP_008945406.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156414|ref|YP_008945406.1|
Domain Number 1 Region: 146-270
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.05e-23
Family Flavohemoglobin, C-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 40-142
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.48e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0044
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.41e-18
Family 2Fe-2S ferredoxin-related 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156414|ref|YP_008945406.1|
Sequence length 366
Comment ferredoxin [Pseudomonas aeruginosa LES431]
Sequence
MALLPLALLTPLLAPLRRLAARGWLREADVDGLLRHAHPLASLNRHYARVEARYWVADDM
LALALRTAPGWPPARPGQHIQLLAERDGVRVGRSYSLTRVVGERLEIAVKRHPDGLLSPW
LCEHLAVGQRVELQPAQGDLRWPMQAEAVCLLAAGSGLTPLLGLLREALENGYRGPVLWL
HYVRHPGQRAWLGELEALAARHPNLELRWSLTRGARADGCLEGHFQPRHLDGWAADLARS
QALACGPAAFVEAVGEQLGARFAGLQTESFSVPRWRSGEAPREVRLRFARSQREVSGDSA
ASLLEQAEAHGLRPAHGCRQGICASCTCVLLSGCVRDLRSGALCSEPGQPIRLCVSAAHG
DLALDL
Download sequence
Identical sequences A0A0C7D6G7 A0A1E9C6U7 A0A1F0I782 A0A1S1BW10
gi|514412016|ref|YP_008135539.1| gi|558675075|ref|YP_008811783.1| 557722.PLES_52751 gi|218893984|ref|YP_002442853.1| WP_003123551.1.100071 WP_003123551.1.100100 WP_003123551.1.100420 WP_003123551.1.100473 WP_003123551.1.100654 WP_003123551.1.100786 WP_003123551.1.100808 WP_003123551.1.100810 WP_003123551.1.100872 WP_003123551.1.100983 WP_003123551.1.100995 WP_003123551.1.101090 WP_003123551.1.101572 WP_003123551.1.101712 WP_003123551.1.10179 WP_003123551.1.101809 WP_003123551.1.10185 WP_003123551.1.101863 WP_003123551.1.10202 WP_003123551.1.10204 WP_003123551.1.102045 WP_003123551.1.10228 WP_003123551.1.10257 WP_003123551.1.1037 WP_003123551.1.10468 WP_003123551.1.10477 WP_003123551.1.10529 WP_003123551.1.10572 WP_003123551.1.10636 WP_003123551.1.10641 WP_003123551.1.10901 WP_003123551.1.11026 WP_003123551.1.11077 WP_003123551.1.1109 WP_003123551.1.11178 WP_003123551.1.11381 WP_003123551.1.11454 WP_003123551.1.11568 WP_003123551.1.11653 WP_003123551.1.11744 WP_003123551.1.1180 WP_003123551.1.11847 WP_003123551.1.11943 WP_003123551.1.12018 WP_003123551.1.12208 WP_003123551.1.12302 WP_003123551.1.12354 WP_003123551.1.1238 WP_003123551.1.12482 WP_003123551.1.12687 WP_003123551.1.12873 WP_003123551.1.12922 WP_003123551.1.12934 WP_003123551.1.12970 WP_003123551.1.13 WP_003123551.1.1305 WP_003123551.1.13208 WP_003123551.1.13232 WP_003123551.1.13407 WP_003123551.1.13529 WP_003123551.1.1356 WP_003123551.1.1362 WP_003123551.1.13622 WP_003123551.1.13765 WP_003123551.1.13785 WP_003123551.1.13828 WP_003123551.1.14078 WP_003123551.1.14378 WP_003123551.1.14424 WP_003123551.1.14460 WP_003123551.1.14640 WP_003123551.1.14714 WP_003123551.1.1475 WP_003123551.1.14797 WP_003123551.1.14820 WP_003123551.1.14966 WP_003123551.1.15004 WP_003123551.1.15130 WP_003123551.1.152 WP_003123551.1.15222 WP_003123551.1.15231 WP_003123551.1.15281 WP_003123551.1.15474 WP_003123551.1.15480 WP_003123551.1.15485 WP_003123551.1.15602 WP_003123551.1.15606 WP_003123551.1.15886 WP_003123551.1.15889 WP_003123551.1.15934 WP_003123551.1.16109 WP_003123551.1.16142 WP_003123551.1.16161 WP_003123551.1.16239 WP_003123551.1.16267 WP_003123551.1.16279 WP_003123551.1.16419 WP_003123551.1.1671 WP_003123551.1.16782 WP_003123551.1.16788 WP_003123551.1.16801 WP_003123551.1.16808 WP_003123551.1.17022 WP_003123551.1.17155 WP_003123551.1.17162 WP_003123551.1.17354 WP_003123551.1.17370 WP_003123551.1.17566 WP_003123551.1.18199 WP_003123551.1.18234 WP_003123551.1.18493 WP_003123551.1.18547 WP_003123551.1.18728 WP_003123551.1.18769 WP_003123551.1.190 WP_003123551.1.19376 WP_003123551.1.19552 WP_003123551.1.1971 WP_003123551.1.19711 WP_003123551.1.19771 WP_003123551.1.20070 WP_003123551.1.20134 WP_003123551.1.20154 WP_003123551.1.20342 WP_003123551.1.20682 WP_003123551.1.20744 WP_003123551.1.20764 WP_003123551.1.20884 WP_003123551.1.209 WP_003123551.1.20929 WP_003123551.1.21242 WP_003123551.1.21302 WP_003123551.1.21349 WP_003123551.1.21358 WP_003123551.1.21448 WP_003123551.1.21517 WP_003123551.1.21607 WP_003123551.1.21718 WP_003123551.1.2172 WP_003123551.1.21744 WP_003123551.1.21871 WP_003123551.1.21891 WP_003123551.1.21932 WP_003123551.1.22078 WP_003123551.1.221 WP_003123551.1.2228 WP_003123551.1.22316 WP_003123551.1.22389 WP_003123551.1.22477 WP_003123551.1.22491 WP_003123551.1.22573 WP_003123551.1.22863 WP_003123551.1.2289 WP_003123551.1.22891 WP_003123551.1.23013 WP_003123551.1.23195 WP_003123551.1.2323 WP_003123551.1.23331 WP_003123551.1.23512 WP_003123551.1.23525 WP_003123551.1.23581 WP_003123551.1.23611 WP_003123551.1.23641 WP_003123551.1.23715 WP_003123551.1.23961 WP_003123551.1.23983 WP_003123551.1.24066 WP_003123551.1.24087 WP_003123551.1.24101 WP_003123551.1.24351 WP_003123551.1.2453 WP_003123551.1.24662 WP_003123551.1.24862 WP_003123551.1.24869 WP_003123551.1.24938 WP_003123551.1.25033 WP_003123551.1.25052 WP_003123551.1.25067 WP_003123551.1.251 WP_003123551.1.25109 WP_003123551.1.25142 WP_003123551.1.25149 WP_003123551.1.25271 WP_003123551.1.25348 WP_003123551.1.25532 WP_003123551.1.25675 WP_003123551.1.25695 WP_003123551.1.2596 WP_003123551.1.26042 WP_003123551.1.261 WP_003123551.1.26334 WP_003123551.1.2652 WP_003123551.1.26539 WP_003123551.1.26604 WP_003123551.1.26682 WP_003123551.1.26816 WP_003123551.1.26841 WP_003123551.1.2698 WP_003123551.1.27018 WP_003123551.1.27039 WP_003123551.1.27211 WP_003123551.1.27218 WP_003123551.1.27259 WP_003123551.1.27505 WP_003123551.1.27534 WP_003123551.1.27587 WP_003123551.1.27738 WP_003123551.1.27772 WP_003123551.1.27825 WP_003123551.1.27837 WP_003123551.1.27939 WP_003123551.1.27966 WP_003123551.1.28006 WP_003123551.1.28064 WP_003123551.1.28136 WP_003123551.1.28175 WP_003123551.1.28258 WP_003123551.1.28383 WP_003123551.1.28404 WP_003123551.1.28468 WP_003123551.1.28505 WP_003123551.1.28560 WP_003123551.1.28623 WP_003123551.1.28823 WP_003123551.1.28849 WP_003123551.1.28920 WP_003123551.1.29096 WP_003123551.1.29137 WP_003123551.1.29208 WP_003123551.1.2927 WP_003123551.1.29401 WP_003123551.1.2941 WP_003123551.1.29472 WP_003123551.1.2948 WP_003123551.1.29481 WP_003123551.1.29498 WP_003123551.1.29501 WP_003123551.1.29577 WP_003123551.1.2980 WP_003123551.1.29848 WP_003123551.1.30000 WP_003123551.1.30120 WP_003123551.1.30254 WP_003123551.1.30365 WP_003123551.1.30567 WP_003123551.1.30614 WP_003123551.1.30707 WP_003123551.1.3072 WP_003123551.1.30886 WP_003123551.1.30994 WP_003123551.1.31045 WP_003123551.1.31076 WP_003123551.1.31087 WP_003123551.1.31105 WP_003123551.1.31138 WP_003123551.1.31147 WP_003123551.1.31279 WP_003123551.1.31501 WP_003123551.1.31565 WP_003123551.1.31587 WP_003123551.1.31741 WP_003123551.1.31848 WP_003123551.1.31939 WP_003123551.1.32134 WP_003123551.1.32137 WP_003123551.1.32289 WP_003123551.1.32544 WP_003123551.1.32869 WP_003123551.1.33097 WP_003123551.1.33133 WP_003123551.1.33152 WP_003123551.1.33186 WP_003123551.1.33210 WP_003123551.1.33216 WP_003123551.1.33455 WP_003123551.1.3351 WP_003123551.1.33523 WP_003123551.1.33549 WP_003123551.1.33658 WP_003123551.1.33733 WP_003123551.1.33734 WP_003123551.1.33822 WP_003123551.1.34000 WP_003123551.1.34039 WP_003123551.1.34143 WP_003123551.1.34151 WP_003123551.1.34191 WP_003123551.1.34306 WP_003123551.1.34317 WP_003123551.1.34402 WP_003123551.1.34625 WP_003123551.1.34670 WP_003123551.1.34832 WP_003123551.1.34837 WP_003123551.1.34878 WP_003123551.1.35036 WP_003123551.1.35149 WP_003123551.1.35281 WP_003123551.1.35325 WP_003123551.1.35573 WP_003123551.1.35679 WP_003123551.1.35682 WP_003123551.1.3576 WP_003123551.1.35762 WP_003123551.1.35768 WP_003123551.1.35857 WP_003123551.1.35872 WP_003123551.1.35984 WP_003123551.1.36170 WP_003123551.1.36521 WP_003123551.1.3653 WP_003123551.1.36587 WP_003123551.1.3672 WP_003123551.1.36781 WP_003123551.1.36879 WP_003123551.1.37125 WP_003123551.1.37163 WP_003123551.1.37172 WP_003123551.1.3721 WP_003123551.1.37366 WP_003123551.1.37512 WP_003123551.1.37814 WP_003123551.1.37842 WP_003123551.1.3785 WP_003123551.1.38003 WP_003123551.1.38146 WP_003123551.1.38151 WP_003123551.1.38186 WP_003123551.1.38319 WP_003123551.1.3833 WP_003123551.1.38430 WP_003123551.1.38450 WP_003123551.1.38502 WP_003123551.1.38505 WP_003123551.1.38583 WP_003123551.1.38657 WP_003123551.1.38661 WP_003123551.1.38706 WP_003123551.1.3887 WP_003123551.1.38889 WP_003123551.1.38971 WP_003123551.1.39088 WP_003123551.1.39122 WP_003123551.1.39186 WP_003123551.1.39271 WP_003123551.1.3943 WP_003123551.1.39444 WP_003123551.1.39458 WP_003123551.1.39537 WP_003123551.1.39786 WP_003123551.1.39811 WP_003123551.1.39949 WP_003123551.1.3998 WP_003123551.1.40059 WP_003123551.1.40207 WP_003123551.1.40213 WP_003123551.1.40243 WP_003123551.1.40512 WP_003123551.1.40541 WP_003123551.1.40950 WP_003123551.1.40994 WP_003123551.1.41291 WP_003123551.1.41301 WP_003123551.1.41412 WP_003123551.1.41502 WP_003123551.1.4156 WP_003123551.1.41618 WP_003123551.1.41625 WP_003123551.1.41725 WP_003123551.1.41732 WP_003123551.1.41832 WP_003123551.1.41888 WP_003123551.1.4190 WP_003123551.1.42146 WP_003123551.1.42259 WP_003123551.1.42423 WP_003123551.1.42463 WP_003123551.1.42508 WP_003123551.1.42643 WP_003123551.1.42757 WP_003123551.1.42778 WP_003123551.1.42789 WP_003123551.1.42854 WP_003123551.1.42856 WP_003123551.1.42917 WP_003123551.1.42946 WP_003123551.1.42952 WP_003123551.1.42973 WP_003123551.1.43024 WP_003123551.1.43106 WP_003123551.1.43107 WP_003123551.1.43293 WP_003123551.1.43315 WP_003123551.1.43330 WP_003123551.1.43356 WP_003123551.1.4348 WP_003123551.1.43662 WP_003123551.1.43673 WP_003123551.1.4381 WP_003123551.1.43826 WP_003123551.1.44094 WP_003123551.1.44213 WP_003123551.1.44260 WP_003123551.1.44581 WP_003123551.1.44739 WP_003123551.1.45063 WP_003123551.1.45090 WP_003123551.1.45146 WP_003123551.1.45199 WP_003123551.1.45202 WP_003123551.1.45228 WP_003123551.1.4532 WP_003123551.1.45328 WP_003123551.1.45358 WP_003123551.1.45464 WP_003123551.1.45478 WP_003123551.1.45485 WP_003123551.1.45837 WP_003123551.1.45934 WP_003123551.1.46010 WP_003123551.1.46032 WP_003123551.1.461 WP_003123551.1.46152 WP_003123551.1.46623 WP_003123551.1.46755 WP_003123551.1.46826 WP_003123551.1.46885 WP_003123551.1.46926 WP_003123551.1.47101 WP_003123551.1.47158 WP_003123551.1.47527 WP_003123551.1.47774 WP_003123551.1.47930 WP_003123551.1.47934 WP_003123551.1.47970 WP_003123551.1.48001 WP_003123551.1.48024 WP_003123551.1.48086 WP_003123551.1.48172 WP_003123551.1.48334 WP_003123551.1.48378 WP_003123551.1.48382 WP_003123551.1.48820 WP_003123551.1.48842 WP_003123551.1.4913 WP_003123551.1.49184 WP_003123551.1.49265 WP_003123551.1.49266 WP_003123551.1.49293 WP_003123551.1.49360 WP_003123551.1.49416 WP_003123551.1.49500 WP_003123551.1.49688 WP_003123551.1.49798 WP_003123551.1.49842 WP_003123551.1.49976 WP_003123551.1.49988 WP_003123551.1.49998 WP_003123551.1.50176 WP_003123551.1.50180 WP_003123551.1.50222 WP_003123551.1.5043 WP_003123551.1.50567 WP_003123551.1.50665 WP_003123551.1.50734 WP_003123551.1.50814 WP_003123551.1.50967 WP_003123551.1.51019 WP_003123551.1.51035 WP_003123551.1.51136 WP_003123551.1.51273 WP_003123551.1.51501 WP_003123551.1.51538 WP_003123551.1.51549 WP_003123551.1.51585 WP_003123551.1.51807 WP_003123551.1.51889 WP_003123551.1.51937 WP_003123551.1.51976 WP_003123551.1.52043 WP_003123551.1.52220 WP_003123551.1.5226 WP_003123551.1.5235 WP_003123551.1.52449 WP_003123551.1.52537 WP_003123551.1.5258 WP_003123551.1.52583 WP_003123551.1.5260 WP_003123551.1.52690 WP_003123551.1.52700 WP_003123551.1.52784 WP_003123551.1.5294 WP_003123551.1.53351 WP_003123551.1.53427 WP_003123551.1.53530 WP_003123551.1.53663 WP_003123551.1.53726 WP_003123551.1.5388 WP_003123551.1.53932 WP_003123551.1.53948 WP_003123551.1.54090 WP_003123551.1.54133 WP_003123551.1.54140 WP_003123551.1.5427 WP_003123551.1.54497 WP_003123551.1.54742 WP_003123551.1.54809 WP_003123551.1.55169 WP_003123551.1.55400 WP_003123551.1.55543 WP_003123551.1.56315 WP_003123551.1.56452 WP_003123551.1.56474 WP_003123551.1.56475 WP_003123551.1.56632 WP_003123551.1.56768 WP_003123551.1.56797 WP_003123551.1.56819 WP_003123551.1.56973 WP_003123551.1.57005 WP_003123551.1.57276 WP_003123551.1.57480 WP_003123551.1.57548 WP_003123551.1.57566 WP_003123551.1.58019 WP_003123551.1.58056 WP_003123551.1.58183 WP_003123551.1.58193 WP_003123551.1.58838 WP_003123551.1.58845 WP_003123551.1.59076 WP_003123551.1.59156 WP_003123551.1.59176 WP_003123551.1.59246 WP_003123551.1.59249 WP_003123551.1.59288 WP_003123551.1.59563 WP_003123551.1.59688 WP_003123551.1.59797 WP_003123551.1.59870 WP_003123551.1.60051 WP_003123551.1.60062 WP_003123551.1.60415 WP_003123551.1.60467 WP_003123551.1.60602 WP_003123551.1.60603 WP_003123551.1.60686 WP_003123551.1.60916 WP_003123551.1.61122 WP_003123551.1.61130 WP_003123551.1.61209 WP_003123551.1.6130 WP_003123551.1.61431 WP_003123551.1.61549 WP_003123551.1.61598 WP_003123551.1.61696 WP_003123551.1.6173 WP_003123551.1.62010 WP_003123551.1.62211 WP_003123551.1.6242 WP_003123551.1.62483 WP_003123551.1.62516 WP_003123551.1.62534 WP_003123551.1.62688 WP_003123551.1.62701 WP_003123551.1.62704 WP_003123551.1.62768 WP_003123551.1.6280 WP_003123551.1.6283 WP_003123551.1.62834 WP_003123551.1.62873 WP_003123551.1.62917 WP_003123551.1.63041 WP_003123551.1.63057 WP_003123551.1.63193 WP_003123551.1.63196 WP_003123551.1.63338 WP_003123551.1.63597 WP_003123551.1.63659 WP_003123551.1.63995 WP_003123551.1.64340 WP_003123551.1.64433 WP_003123551.1.64748 WP_003123551.1.64799 WP_003123551.1.64807 WP_003123551.1.64854 WP_003123551.1.64862 WP_003123551.1.64880 WP_003123551.1.64984 WP_003123551.1.65009 WP_003123551.1.65092 WP_003123551.1.65099 WP_003123551.1.65145 WP_003123551.1.65227 WP_003123551.1.65237 WP_003123551.1.65247 WP_003123551.1.65337 WP_003123551.1.65642 WP_003123551.1.65819 WP_003123551.1.65867 WP_003123551.1.6589 WP_003123551.1.65926 WP_003123551.1.66165 WP_003123551.1.6629 WP_003123551.1.66348 WP_003123551.1.66371 WP_003123551.1.66526 WP_003123551.1.66634 WP_003123551.1.66721 WP_003123551.1.66892 WP_003123551.1.66929 WP_003123551.1.66950 WP_003123551.1.67188 WP_003123551.1.67205 WP_003123551.1.67261 WP_003123551.1.67269 WP_003123551.1.67370 WP_003123551.1.67388 WP_003123551.1.67472 WP_003123551.1.67526 WP_003123551.1.67531 WP_003123551.1.67686 WP_003123551.1.67755 WP_003123551.1.67830 WP_003123551.1.67948 WP_003123551.1.68183 WP_003123551.1.68252 WP_003123551.1.68317 WP_003123551.1.68472 WP_003123551.1.68541 WP_003123551.1.68638 WP_003123551.1.68756 WP_003123551.1.68781 WP_003123551.1.68850 WP_003123551.1.68862 WP_003123551.1.68938 WP_003123551.1.69159 WP_003123551.1.69260 WP_003123551.1.6928 WP_003123551.1.69599 WP_003123551.1.69702 WP_003123551.1.69788 WP_003123551.1.69993 WP_003123551.1.70092 WP_003123551.1.70098 WP_003123551.1.70168 WP_003123551.1.70194 WP_003123551.1.70216 WP_003123551.1.70229 WP_003123551.1.70460 WP_003123551.1.70561 WP_003123551.1.70648 WP_003123551.1.70677 WP_003123551.1.70693 WP_003123551.1.7077 WP_003123551.1.70778 WP_003123551.1.70991 WP_003123551.1.71038 WP_003123551.1.7128 WP_003123551.1.71346 WP_003123551.1.71570 WP_003123551.1.72149 WP_003123551.1.72167 WP_003123551.1.72181 WP_003123551.1.72287 WP_003123551.1.72323 WP_003123551.1.72331 WP_003123551.1.72541 WP_003123551.1.72768 WP_003123551.1.73048 WP_003123551.1.7308 WP_003123551.1.73149 WP_003123551.1.73172 WP_003123551.1.7327 WP_003123551.1.733 WP_003123551.1.73490 WP_003123551.1.73523 WP_003123551.1.73541 WP_003123551.1.73791 WP_003123551.1.7382 WP_003123551.1.73860 WP_003123551.1.73911 WP_003123551.1.74 WP_003123551.1.7408 WP_003123551.1.74167 WP_003123551.1.74175 WP_003123551.1.74219 WP_003123551.1.74458 WP_003123551.1.74473 WP_003123551.1.74475 WP_003123551.1.74518 WP_003123551.1.7456 WP_003123551.1.74568 WP_003123551.1.74629 WP_003123551.1.748 WP_003123551.1.74948 WP_003123551.1.74958 WP_003123551.1.75041 WP_003123551.1.75204 WP_003123551.1.75277 WP_003123551.1.7547 WP_003123551.1.75549 WP_003123551.1.75573 WP_003123551.1.75599 WP_003123551.1.75771 WP_003123551.1.75935 WP_003123551.1.7595 WP_003123551.1.76092 WP_003123551.1.76322 WP_003123551.1.76355 WP_003123551.1.76383 WP_003123551.1.76399 WP_003123551.1.76543 WP_003123551.1.76600 WP_003123551.1.76716 WP_003123551.1.76985 WP_003123551.1.77235 WP_003123551.1.77238 WP_003123551.1.77286 WP_003123551.1.77317 WP_003123551.1.77476 WP_003123551.1.77490 WP_003123551.1.77750 WP_003123551.1.77769 WP_003123551.1.77819 WP_003123551.1.77913 WP_003123551.1.78112 WP_003123551.1.78134 WP_003123551.1.78280 WP_003123551.1.78380 WP_003123551.1.78409 WP_003123551.1.78430 WP_003123551.1.78570 WP_003123551.1.78623 WP_003123551.1.78693 WP_003123551.1.78795 WP_003123551.1.78810 WP_003123551.1.78986 WP_003123551.1.79007 WP_003123551.1.79256 WP_003123551.1.79279 WP_003123551.1.79311 WP_003123551.1.79364 WP_003123551.1.79431 WP_003123551.1.7945 WP_003123551.1.79507 WP_003123551.1.79544 WP_003123551.1.79569 WP_003123551.1.79699 WP_003123551.1.79788 WP_003123551.1.79908 WP_003123551.1.80068 WP_003123551.1.80087 WP_003123551.1.8028 WP_003123551.1.80306 WP_003123551.1.80410 WP_003123551.1.80411 WP_003123551.1.8064 WP_003123551.1.80720 WP_003123551.1.80880 WP_003123551.1.80931 WP_003123551.1.80938 WP_003123551.1.81081 WP_003123551.1.81082 WP_003123551.1.8110 WP_003123551.1.81237 WP_003123551.1.81331 WP_003123551.1.81482 WP_003123551.1.81591 WP_003123551.1.81622 WP_003123551.1.81742 WP_003123551.1.81816 WP_003123551.1.81834 WP_003123551.1.81844 WP_003123551.1.81950 WP_003123551.1.81957 WP_003123551.1.81960 WP_003123551.1.82117 WP_003123551.1.82127 WP_003123551.1.82328 WP_003123551.1.82604 WP_003123551.1.82643 WP_003123551.1.82864 WP_003123551.1.82936 WP_003123551.1.83025 WP_003123551.1.83131 WP_003123551.1.83184 WP_003123551.1.83213 WP_003123551.1.83251 WP_003123551.1.83296 WP_003123551.1.83394 WP_003123551.1.835 WP_003123551.1.83637 WP_003123551.1.83698 WP_003123551.1.83946 WP_003123551.1.84003 WP_003123551.1.84008 WP_003123551.1.84177 WP_003123551.1.84190 WP_003123551.1.84297 WP_003123551.1.84374 WP_003123551.1.84398 WP_003123551.1.84439 WP_003123551.1.8453 WP_003123551.1.84674 WP_003123551.1.84702 WP_003123551.1.84754 WP_003123551.1.8484 WP_003123551.1.84937 WP_003123551.1.85028 WP_003123551.1.85220 WP_003123551.1.85290 WP_003123551.1.85318 WP_003123551.1.85897 WP_003123551.1.86047 WP_003123551.1.86125 WP_003123551.1.86278 WP_003123551.1.86386 WP_003123551.1.86545 WP_003123551.1.86552 WP_003123551.1.86652 WP_003123551.1.86785 WP_003123551.1.86813 WP_003123551.1.86947 WP_003123551.1.86985 WP_003123551.1.8718 WP_003123551.1.8727 WP_003123551.1.87435 WP_003123551.1.87530 WP_003123551.1.87547 WP_003123551.1.87648 WP_003123551.1.87763 WP_003123551.1.87970 WP_003123551.1.88308 WP_003123551.1.88388 WP_003123551.1.88517 WP_003123551.1.88578 WP_003123551.1.88605 WP_003123551.1.88679 WP_003123551.1.88714 WP_003123551.1.89098 WP_003123551.1.8911 WP_003123551.1.89276 WP_003123551.1.89409 WP_003123551.1.89434 WP_003123551.1.89577 WP_003123551.1.89662 WP_003123551.1.89736 WP_003123551.1.89805 WP_003123551.1.89866 WP_003123551.1.89868 WP_003123551.1.90056 WP_003123551.1.90141 WP_003123551.1.90150 WP_003123551.1.90224 WP_003123551.1.90225 WP_003123551.1.90242 WP_003123551.1.90306 WP_003123551.1.90412 WP_003123551.1.9056 WP_003123551.1.90569 WP_003123551.1.90770 WP_003123551.1.90940 WP_003123551.1.91161 WP_003123551.1.9120 WP_003123551.1.91204 WP_003123551.1.9143 WP_003123551.1.91431 WP_003123551.1.91438 WP_003123551.1.91563 WP_003123551.1.91585 WP_003123551.1.91803 WP_003123551.1.9182 WP_003123551.1.91846 WP_003123551.1.9191 WP_003123551.1.91943 WP_003123551.1.92043 WP_003123551.1.92314 WP_003123551.1.92454 WP_003123551.1.92573 WP_003123551.1.92585 WP_003123551.1.92587 WP_003123551.1.92624 WP_003123551.1.92769 WP_003123551.1.92847 WP_003123551.1.92894 WP_003123551.1.92924 WP_003123551.1.92930 WP_003123551.1.93130 WP_003123551.1.93144 WP_003123551.1.9328 WP_003123551.1.93498 WP_003123551.1.94004 WP_003123551.1.94031 WP_003123551.1.94174 WP_003123551.1.94243 WP_003123551.1.94422 WP_003123551.1.94434 WP_003123551.1.9444 WP_003123551.1.94682 WP_003123551.1.94814 WP_003123551.1.94856 WP_003123551.1.94874 WP_003123551.1.95027 WP_003123551.1.95056 WP_003123551.1.95117 WP_003123551.1.95132 WP_003123551.1.95187 WP_003123551.1.95460 WP_003123551.1.95488 WP_003123551.1.95525 WP_003123551.1.95536 WP_003123551.1.95668 WP_003123551.1.95745 WP_003123551.1.95751 WP_003123551.1.95820 WP_003123551.1.95825 WP_003123551.1.9599 WP_003123551.1.96193 WP_003123551.1.96267 WP_003123551.1.96434 WP_003123551.1.96506 WP_003123551.1.96967 WP_003123551.1.9706 WP_003123551.1.97118 WP_003123551.1.97126 WP_003123551.1.97213 WP_003123551.1.9722 WP_003123551.1.97474 WP_003123551.1.97614 WP_003123551.1.97877 WP_003123551.1.97968 WP_003123551.1.98410 WP_003123551.1.98414 WP_003123551.1.98433 WP_003123551.1.98573 WP_003123551.1.98610 WP_003123551.1.98672 WP_003123551.1.98678 WP_003123551.1.98788 WP_003123551.1.98907 WP_003123551.1.98926 WP_003123551.1.99068 WP_003123551.1.99353 WP_003123551.1.99654 WP_003123551.1.99662 WP_003123551.1.99746 WP_003123551.1.99757 WP_003123551.1.99795 gi|558668724|ref|YP_008805434.1| gi|568156414|ref|YP_008945406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]