SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156430|ref|YP_008945422.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156430|ref|YP_008945422.1|
Domain Number 1 Region: 209-316
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.51e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.008
Further Details:      
 
Domain Number 2 Region: 102-221
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-28
Family Aromatic dioxygenase reductase-like 0.017
Further Details:      
 
Domain Number 3 Region: 2-96
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.96e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568156430|ref|YP_008945422.1|
Sequence length 317
Comment Vanillate O-demethylase oxidoreductase [Pseudomonas aeruginosa LES431]
Sequence
MIEVIVGAIRLEAQDIHSFELFRADGAALPSFEPGAHIDLHLPNGLVRQYSLCGPAERPR
HYRIAVLRCRDSRGGSATLHAELRVGQRLRIGEPRNLFPLSPEPGPRLLFAGGIGITPLL
AMAERLARDGADFQLHYCAHSAERAAFVDYLGRCAFADRVHCHFDHGESSRRADLRALLA
TSPRDAQLYLCGPAGFMQWIEESARELGWEASRLHREHFAAAPRDANADGTFEVQLASNG
ALIRVAAGQTVLAALREAGVDLPASCEQGICGTCLTRVLDGEPEHRDLYLSEEEQAANDC
FTPCCSRSRSPRLVLDL
Download sequence
Identical sequences WP_012614608.1.11026 WP_012614608.1.11943 WP_012614608.1.13232 WP_012614608.1.14714 WP_012614608.1.1475 WP_012614608.1.21517 WP_012614608.1.22863 WP_012614608.1.23195 WP_012614608.1.23715 WP_012614608.1.24351 WP_012614608.1.251 WP_012614608.1.25142 WP_012614608.1.27837 WP_012614608.1.31279 WP_012614608.1.32544 WP_012614608.1.33210 WP_012614608.1.34832 WP_012614608.1.35857 WP_012614608.1.3833 WP_012614608.1.38502 WP_012614608.1.39088 WP_012614608.1.43662 WP_012614608.1.45090 WP_012614608.1.45485 WP_012614608.1.45934 WP_012614608.1.46152 WP_012614608.1.47774 WP_012614608.1.52690 WP_012614608.1.56797 WP_012614608.1.59076 WP_012614608.1.60415 WP_012614608.1.60603 WP_012614608.1.61696 WP_012614608.1.62516 WP_012614608.1.62534 WP_012614608.1.62701 WP_012614608.1.65099 WP_012614608.1.66526 WP_012614608.1.67388 WP_012614608.1.67686 WP_012614608.1.68862 WP_012614608.1.72331 WP_012614608.1.73149 WP_012614608.1.7547 WP_012614608.1.78430 WP_012614608.1.84374 WP_012614608.1.86545 WP_012614608.1.87435 WP_012614608.1.89992 WP_012614608.1.91431 WP_012614608.1.92624 WP_012614608.1.92769 WP_012614608.1.95460 WP_012614608.1.9722 WP_012614608.1.99461 WP_012614608.1.99757 gi|218894000|ref|YP_002442869.1| gi|568156430|ref|YP_008945422.1| 557722.PLES_52911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]