SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156764|ref|YP_008945757.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156764|ref|YP_008945757.1|
Domain Number 1 Region: 192-317
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.11e-30
Family Reductases 0.038
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.12e-16
Family 2Fe-2S ferredoxin-related 0.0068
Further Details:      
 
Domain Number 3 Region: 92-186
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000000089
Family Ferredoxin reductase FAD-binding domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568156764|ref|YP_008945757.1|
Sequence length 322
Comment CDP-6-deoxy-delta-3,4-glucoseen reductase [Pseudomonas aeruginosa LES431]
Sequence
MRIVLQPSGACLELLPGERILDGARRLGYDCPQSCRNGNCHICAALLVEGRVRQNGEVRD
HGELFTCLAEPLEDCVLHWDGVLAPGELPLRKLTCQLSFCEEVGGDVYRVGLRAPAGKPP
RYHAGQYLLLERDGGDSAAFSLASAPHAGRDLELHILAKEDSAVALIAQLQRERLARIQL
PFGDAHLAELPDGPLVLIAAGTGMSQMHSLIEHCRAAGFAHPVHLYWGVRRPEDFYRLPH
WTEWEGLPNLFLHRVVSDLCGWEGRCGLLHEAVREDFADLSSLHVYASGSPAMVYATLDA
LVEAGMDAHQMRADVFAYAPRD
Download sequence
Identical sequences A0A072ZUJ3 A0A0H2ZJ48 A0A0H3QWD2 A0A157WHD4 A0A1C7BIK4 A0A1E9C7K2 A0A1F0I808 A0A1G5HPD6 A0A1S1C0B9 Q9HTV4 V6ANS8 W1MVJ2
gi|568312685|ref|YP_008984954.1| gi|386068888|ref|YP_005984192.1| gi|558675429|ref|YP_008812137.1| NP_253923.1.87394 WP_003096331.1.100071 WP_003096331.1.100100 WP_003096331.1.100179 WP_003096331.1.100278 WP_003096331.1.100319 WP_003096331.1.100394 WP_003096331.1.100420 WP_003096331.1.100456 WP_003096331.1.100469 WP_003096331.1.100473 WP_003096331.1.100476 WP_003096331.1.100523 WP_003096331.1.100654 WP_003096331.1.100723 WP_003096331.1.100777 WP_003096331.1.100786 WP_003096331.1.100808 WP_003096331.1.100809 WP_003096331.1.100810 WP_003096331.1.100872 WP_003096331.1.100983 WP_003096331.1.101021 WP_003096331.1.101047 WP_003096331.1.101090 WP_003096331.1.101269 WP_003096331.1.101310 WP_003096331.1.101340 WP_003096331.1.101506 WP_003096331.1.101572 WP_003096331.1.101590 WP_003096331.1.101642 WP_003096331.1.101712 WP_003096331.1.101739 WP_003096331.1.10174 WP_003096331.1.101781 WP_003096331.1.10179 WP_003096331.1.101809 WP_003096331.1.101819 WP_003096331.1.10185 WP_003096331.1.101863 WP_003096331.1.101871 WP_003096331.1.10201 WP_003096331.1.10202 WP_003096331.1.10204 WP_003096331.1.102045 WP_003096331.1.10228 WP_003096331.1.10248 WP_003096331.1.10257 WP_003096331.1.1037 WP_003096331.1.10407 WP_003096331.1.10419 WP_003096331.1.10435 WP_003096331.1.10468 WP_003096331.1.10477 WP_003096331.1.10482 WP_003096331.1.10513 WP_003096331.1.10529 WP_003096331.1.10548 WP_003096331.1.10572 WP_003096331.1.10575 WP_003096331.1.10636 WP_003096331.1.10641 WP_003096331.1.10684 WP_003096331.1.10764 WP_003096331.1.10856 WP_003096331.1.10895 WP_003096331.1.10901 WP_003096331.1.10949 WP_003096331.1.11026 WP_003096331.1.11058 WP_003096331.1.11077 WP_003096331.1.1109 WP_003096331.1.11130 WP_003096331.1.11163 WP_003096331.1.11178 WP_003096331.1.11180 WP_003096331.1.11318 WP_003096331.1.11381 WP_003096331.1.11388 WP_003096331.1.11410 WP_003096331.1.11417 WP_003096331.1.11454 WP_003096331.1.11568 WP_003096331.1.11569 WP_003096331.1.11653 WP_003096331.1.11744 WP_003096331.1.11754 WP_003096331.1.1180 WP_003096331.1.1183 WP_003096331.1.11847 WP_003096331.1.1187 WP_003096331.1.11943 WP_003096331.1.12018 WP_003096331.1.12081 WP_003096331.1.12120 WP_003096331.1.12150 WP_003096331.1.12200 WP_003096331.1.12208 WP_003096331.1.12240 WP_003096331.1.12302 WP_003096331.1.1238 WP_003096331.1.12482 WP_003096331.1.12530 WP_003096331.1.12547 WP_003096331.1.12657 WP_003096331.1.12660 WP_003096331.1.12670 WP_003096331.1.12687 WP_003096331.1.12744 WP_003096331.1.12797 WP_003096331.1.12873 WP_003096331.1.12890 WP_003096331.1.12891 WP_003096331.1.12922 WP_003096331.1.12930 WP_003096331.1.12934 WP_003096331.1.12970 WP_003096331.1.13 WP_003096331.1.1305 WP_003096331.1.13057 WP_003096331.1.13077 WP_003096331.1.13085 WP_003096331.1.13092 WP_003096331.1.13208 WP_003096331.1.13232 WP_003096331.1.13242 WP_003096331.1.13266 WP_003096331.1.13270 WP_003096331.1.13315 WP_003096331.1.1333 WP_003096331.1.13364 WP_003096331.1.13407 WP_003096331.1.13529 WP_003096331.1.13533 WP_003096331.1.1356 WP_003096331.1.1362 WP_003096331.1.13622 WP_003096331.1.13642 WP_003096331.1.13718 WP_003096331.1.13743 WP_003096331.1.13758 WP_003096331.1.13765 WP_003096331.1.13785 WP_003096331.1.13795 WP_003096331.1.13828 WP_003096331.1.13865 WP_003096331.1.1393 WP_003096331.1.14049 WP_003096331.1.14078 WP_003096331.1.14096 WP_003096331.1.14116 WP_003096331.1.14204 WP_003096331.1.14251 WP_003096331.1.14378 WP_003096331.1.14424 WP_003096331.1.14455 WP_003096331.1.14460 WP_003096331.1.14463 WP_003096331.1.14476 WP_003096331.1.14525 WP_003096331.1.14564 WP_003096331.1.14615 WP_003096331.1.14640 WP_003096331.1.14679 WP_003096331.1.14690 WP_003096331.1.14714 WP_003096331.1.1475 WP_003096331.1.14754 WP_003096331.1.14797 WP_003096331.1.14815 WP_003096331.1.14820 WP_003096331.1.14835 WP_003096331.1.14839 WP_003096331.1.14883 WP_003096331.1.14966 WP_003096331.1.14981 WP_003096331.1.15004 WP_003096331.1.15130 WP_003096331.1.1516 WP_003096331.1.152 WP_003096331.1.15222 WP_003096331.1.15231 WP_003096331.1.15281 WP_003096331.1.15297 WP_003096331.1.15328 WP_003096331.1.15373 WP_003096331.1.15379 WP_003096331.1.15408 WP_003096331.1.15474 WP_003096331.1.15480 WP_003096331.1.15482 WP_003096331.1.15485 WP_003096331.1.15602 WP_003096331.1.15666 WP_003096331.1.15886 WP_003096331.1.15889 WP_003096331.1.15934 WP_003096331.1.16074 WP_003096331.1.16109 WP_003096331.1.16142 WP_003096331.1.16161 WP_003096331.1.16197 WP_003096331.1.162 WP_003096331.1.16239 WP_003096331.1.16242 WP_003096331.1.16267 WP_003096331.1.16279 WP_003096331.1.16419 WP_003096331.1.1646 WP_003096331.1.16660 WP_003096331.1.16694 WP_003096331.1.1671 WP_003096331.1.16751 WP_003096331.1.16782 WP_003096331.1.16788 WP_003096331.1.16801 WP_003096331.1.16808 WP_003096331.1.16811 WP_003096331.1.16895 WP_003096331.1.17022 WP_003096331.1.1704 WP_003096331.1.17108 WP_003096331.1.17155 WP_003096331.1.17162 WP_003096331.1.17177 WP_003096331.1.17189 WP_003096331.1.172 WP_003096331.1.17223 WP_003096331.1.17353 WP_003096331.1.17370 WP_003096331.1.1739 WP_003096331.1.17397 WP_003096331.1.17499 WP_003096331.1.17566 WP_003096331.1.1758 WP_003096331.1.1761 WP_003096331.1.17697 WP_003096331.1.17883 WP_003096331.1.17890 WP_003096331.1.18052 WP_003096331.1.18054 WP_003096331.1.18117 WP_003096331.1.18156 WP_003096331.1.18157 WP_003096331.1.18199 WP_003096331.1.18204 WP_003096331.1.18234 WP_003096331.1.18349 WP_003096331.1.18440 WP_003096331.1.18493 WP_003096331.1.18508 WP_003096331.1.18547 WP_003096331.1.18653 WP_003096331.1.18728 WP_003096331.1.18732 WP_003096331.1.18735 WP_003096331.1.18769 WP_003096331.1.18795 WP_003096331.1.18852 WP_003096331.1.18892 WP_003096331.1.18907 WP_003096331.1.18911 WP_003096331.1.18930 WP_003096331.1.190 WP_003096331.1.19089 WP_003096331.1.19199 WP_003096331.1.19251 WP_003096331.1.19260 WP_003096331.1.19269 WP_003096331.1.19346 WP_003096331.1.19351 WP_003096331.1.19376 WP_003096331.1.1938 WP_003096331.1.19552 WP_003096331.1.19591 WP_003096331.1.19640 WP_003096331.1.19703 WP_003096331.1.1971 WP_003096331.1.19711 WP_003096331.1.19718 WP_003096331.1.19741 WP_003096331.1.19771 WP_003096331.1.19803 WP_003096331.1.19930 WP_003096331.1.19931 WP_003096331.1.20070 WP_003096331.1.2012 WP_003096331.1.20125 WP_003096331.1.20134 WP_003096331.1.20216 WP_003096331.1.20342 WP_003096331.1.20590 WP_003096331.1.20682 WP_003096331.1.20692 WP_003096331.1.20744 WP_003096331.1.20764 WP_003096331.1.20825 WP_003096331.1.20854 WP_003096331.1.20880 WP_003096331.1.20884 WP_003096331.1.20890 WP_003096331.1.209 WP_003096331.1.20929 WP_003096331.1.20978 WP_003096331.1.21002 WP_003096331.1.21039 WP_003096331.1.21096 WP_003096331.1.21100 WP_003096331.1.21166 WP_003096331.1.21209 WP_003096331.1.21242 WP_003096331.1.21253 WP_003096331.1.21302 WP_003096331.1.21349 WP_003096331.1.21358 WP_003096331.1.2144 WP_003096331.1.21448 WP_003096331.1.21460 WP_003096331.1.21469 WP_003096331.1.21471 WP_003096331.1.21517 WP_003096331.1.21607 WP_003096331.1.21718 WP_003096331.1.2172 WP_003096331.1.21744 WP_003096331.1.21767 WP_003096331.1.21782 WP_003096331.1.21801 WP_003096331.1.21871 WP_003096331.1.21891 WP_003096331.1.21932 WP_003096331.1.22078 WP_003096331.1.221 WP_003096331.1.2228 WP_003096331.1.22324 WP_003096331.1.22365 WP_003096331.1.2237 WP_003096331.1.22390 WP_003096331.1.22394 WP_003096331.1.22442 WP_003096331.1.22477 WP_003096331.1.22491 WP_003096331.1.22573 WP_003096331.1.22671 WP_003096331.1.22704 WP_003096331.1.22729 WP_003096331.1.22863 WP_003096331.1.2289 WP_003096331.1.22891 WP_003096331.1.23013 WP_003096331.1.23166 WP_003096331.1.23191 WP_003096331.1.23195 WP_003096331.1.2323 WP_003096331.1.23264 WP_003096331.1.23331 WP_003096331.1.23418 WP_003096331.1.23421 WP_003096331.1.23512 WP_003096331.1.23518 WP_003096331.1.23523 WP_003096331.1.23525 WP_003096331.1.2355 WP_003096331.1.23559 WP_003096331.1.23581 WP_003096331.1.236 WP_003096331.1.23611 WP_003096331.1.23641 WP_003096331.1.23715 WP_003096331.1.23739 WP_003096331.1.23769 WP_003096331.1.23782 WP_003096331.1.23794 WP_003096331.1.23884 WP_003096331.1.23925 WP_003096331.1.23938 WP_003096331.1.23961 WP_003096331.1.23967 WP_003096331.1.23983 WP_003096331.1.24066 WP_003096331.1.24077 WP_003096331.1.24087 WP_003096331.1.24101 WP_003096331.1.24234 WP_003096331.1.24319 WP_003096331.1.24351 WP_003096331.1.24413 WP_003096331.1.2453 WP_003096331.1.24626 WP_003096331.1.24662 WP_003096331.1.2477 WP_003096331.1.24851 WP_003096331.1.24862 WP_003096331.1.24869 WP_003096331.1.24879 WP_003096331.1.24938 WP_003096331.1.24940 WP_003096331.1.25033 WP_003096331.1.25052 WP_003096331.1.25067 WP_003096331.1.25075 WP_003096331.1.251 WP_003096331.1.25109 WP_003096331.1.2511 WP_003096331.1.25142 WP_003096331.1.25149 WP_003096331.1.25179 WP_003096331.1.25191 WP_003096331.1.25271 WP_003096331.1.2529 WP_003096331.1.2530 WP_003096331.1.25328 WP_003096331.1.25344 WP_003096331.1.25348 WP_003096331.1.2535 WP_003096331.1.25477 WP_003096331.1.25532 WP_003096331.1.25600 WP_003096331.1.25641 WP_003096331.1.25695 WP_003096331.1.2572 WP_003096331.1.25834 WP_003096331.1.25903 WP_003096331.1.2596 WP_003096331.1.25964 WP_003096331.1.26010 WP_003096331.1.26025 WP_003096331.1.26042 WP_003096331.1.261 WP_003096331.1.26159 WP_003096331.1.26301 WP_003096331.1.26334 WP_003096331.1.26428 WP_003096331.1.26463 WP_003096331.1.26473 WP_003096331.1.26489 WP_003096331.1.2652 WP_003096331.1.26539 WP_003096331.1.26553 WP_003096331.1.26592 WP_003096331.1.26604 WP_003096331.1.26681 WP_003096331.1.26682 WP_003096331.1.26705 WP_003096331.1.26740 WP_003096331.1.26816 WP_003096331.1.26841 WP_003096331.1.26862 WP_003096331.1.26906 WP_003096331.1.27018 WP_003096331.1.27028 WP_003096331.1.27073 WP_003096331.1.27107 WP_003096331.1.27211 WP_003096331.1.27218 WP_003096331.1.27259 WP_003096331.1.27288 WP_003096331.1.27505 WP_003096331.1.27534 WP_003096331.1.27549 WP_003096331.1.27575 WP_003096331.1.27587 WP_003096331.1.27687 WP_003096331.1.27738 WP_003096331.1.27783 WP_003096331.1.27825 WP_003096331.1.27837 WP_003096331.1.27858 WP_003096331.1.27933 WP_003096331.1.27939 WP_003096331.1.27966 WP_003096331.1.28006 WP_003096331.1.28057 WP_003096331.1.28064 WP_003096331.1.28078 WP_003096331.1.28136 WP_003096331.1.28175 WP_003096331.1.28193 WP_003096331.1.28258 WP_003096331.1.283 WP_003096331.1.28316 WP_003096331.1.28329 WP_003096331.1.28372 WP_003096331.1.28383 WP_003096331.1.28404 WP_003096331.1.28468 WP_003096331.1.28560 WP_003096331.1.28699 WP_003096331.1.28713 WP_003096331.1.28757 WP_003096331.1.28800 WP_003096331.1.28823 WP_003096331.1.28849 WP_003096331.1.28878 WP_003096331.1.28920 WP_003096331.1.29008 WP_003096331.1.29070 WP_003096331.1.29096 WP_003096331.1.29127 WP_003096331.1.29137 WP_003096331.1.29158 WP_003096331.1.29179 WP_003096331.1.29208 WP_003096331.1.2927 WP_003096331.1.29401 WP_003096331.1.2941 WP_003096331.1.29440 WP_003096331.1.29472 WP_003096331.1.2948 WP_003096331.1.29481 WP_003096331.1.29498 WP_003096331.1.29501 WP_003096331.1.29577 WP_003096331.1.2961 WP_003096331.1.29633 WP_003096331.1.29650 WP_003096331.1.29668 WP_003096331.1.29753 WP_003096331.1.29767 WP_003096331.1.2980 WP_003096331.1.29848 WP_003096331.1.29920 WP_003096331.1.29958 WP_003096331.1.29973 WP_003096331.1.30000 WP_003096331.1.30020 WP_003096331.1.30081 WP_003096331.1.30254 WP_003096331.1.3030 WP_003096331.1.30365 WP_003096331.1.30474 WP_003096331.1.30475 WP_003096331.1.30563 WP_003096331.1.30567 WP_003096331.1.30614 WP_003096331.1.30615 WP_003096331.1.30625 WP_003096331.1.30693 WP_003096331.1.30707 WP_003096331.1.3072 WP_003096331.1.30740 WP_003096331.1.30797 WP_003096331.1.30815 WP_003096331.1.30842 WP_003096331.1.30886 WP_003096331.1.30943 WP_003096331.1.30973 WP_003096331.1.30994 WP_003096331.1.31045 WP_003096331.1.31076 WP_003096331.1.31087 WP_003096331.1.31103 WP_003096331.1.31105 WP_003096331.1.31138 WP_003096331.1.31147 WP_003096331.1.31279 WP_003096331.1.31361 WP_003096331.1.31457 WP_003096331.1.31501 WP_003096331.1.31563 WP_003096331.1.31565 WP_003096331.1.31633 WP_003096331.1.31655 WP_003096331.1.3172 WP_003096331.1.31732 WP_003096331.1.31741 WP_003096331.1.31751 WP_003096331.1.31848 WP_003096331.1.31852 WP_003096331.1.319 WP_003096331.1.31939 WP_003096331.1.32134 WP_003096331.1.32137 WP_003096331.1.32144 WP_003096331.1.32235 WP_003096331.1.32289 WP_003096331.1.32314 WP_003096331.1.32359 WP_003096331.1.32523 WP_003096331.1.32544 WP_003096331.1.32596 WP_003096331.1.32626 WP_003096331.1.32637 WP_003096331.1.32641 WP_003096331.1.32711 WP_003096331.1.32821 WP_003096331.1.32869 WP_003096331.1.32879 WP_003096331.1.32998 WP_003096331.1.33009 WP_003096331.1.33047 WP_003096331.1.33097 WP_003096331.1.33133 WP_003096331.1.33152 WP_003096331.1.33186 WP_003096331.1.33204 WP_003096331.1.33210 WP_003096331.1.33216 WP_003096331.1.33294 WP_003096331.1.33340 WP_003096331.1.33387 WP_003096331.1.33438 WP_003096331.1.33455 WP_003096331.1.3351 WP_003096331.1.33521 WP_003096331.1.33523 WP_003096331.1.33547 WP_003096331.1.33549 WP_003096331.1.33658 WP_003096331.1.33669 WP_003096331.1.33728 WP_003096331.1.33733 WP_003096331.1.33734 WP_003096331.1.3376 WP_003096331.1.33774 WP_003096331.1.33801 WP_003096331.1.33822 WP_003096331.1.33824 WP_003096331.1.33833 WP_003096331.1.3385 WP_003096331.1.33945 WP_003096331.1.34000 WP_003096331.1.34039 WP_003096331.1.34150 WP_003096331.1.34151 WP_003096331.1.34180 WP_003096331.1.34191 WP_003096331.1.34203 WP_003096331.1.34306 WP_003096331.1.34317 WP_003096331.1.34324 WP_003096331.1.34401 WP_003096331.1.34402 WP_003096331.1.34461 WP_003096331.1.3452 WP_003096331.1.34556 WP_003096331.1.34568 WP_003096331.1.34583 WP_003096331.1.34625 WP_003096331.1.34670 WP_003096331.1.34689 WP_003096331.1.34832 WP_003096331.1.34837 WP_003096331.1.34876 WP_003096331.1.34878 WP_003096331.1.34942 WP_003096331.1.35036 WP_003096331.1.35104 WP_003096331.1.35149 WP_003096331.1.35231 WP_003096331.1.35281 WP_003096331.1.3531 WP_003096331.1.35325 WP_003096331.1.35353 WP_003096331.1.3540 WP_003096331.1.35431 WP_003096331.1.35442 WP_003096331.1.35480 WP_003096331.1.35512 WP_003096331.1.35529 WP_003096331.1.3555 WP_003096331.1.35573 WP_003096331.1.35599 WP_003096331.1.35641 WP_003096331.1.35669 WP_003096331.1.35679 WP_003096331.1.3568 WP_003096331.1.35682 WP_003096331.1.3576 WP_003096331.1.35762 WP_003096331.1.35768 WP_003096331.1.35822 WP_003096331.1.35843 WP_003096331.1.35857 WP_003096331.1.35872 WP_003096331.1.35968 WP_003096331.1.35984 WP_003096331.1.36064 WP_003096331.1.36121 WP_003096331.1.36148 WP_003096331.1.36170 WP_003096331.1.36266 WP_003096331.1.36267 WP_003096331.1.36285 WP_003096331.1.36378 WP_003096331.1.36435 WP_003096331.1.36487 WP_003096331.1.36521 WP_003096331.1.3653 WP_003096331.1.36587 WP_003096331.1.36608 WP_003096331.1.3662 WP_003096331.1.36630 WP_003096331.1.36665 WP_003096331.1.36708 WP_003096331.1.36756 WP_003096331.1.36781 WP_003096331.1.37050 WP_003096331.1.37097 WP_003096331.1.37125 WP_003096331.1.37163 WP_003096331.1.37172 WP_003096331.1.37208 WP_003096331.1.3721 WP_003096331.1.37216 WP_003096331.1.373 WP_003096331.1.37319 WP_003096331.1.37366 WP_003096331.1.37416 WP_003096331.1.3742 WP_003096331.1.37512 WP_003096331.1.37571 WP_003096331.1.3768 WP_003096331.1.37698 WP_003096331.1.37703 WP_003096331.1.3773 WP_003096331.1.37799 WP_003096331.1.3781 WP_003096331.1.37818 WP_003096331.1.37826 WP_003096331.1.37842 WP_003096331.1.3785 WP_003096331.1.3792 WP_003096331.1.38003 WP_003096331.1.38023 WP_003096331.1.38060 WP_003096331.1.38087 WP_003096331.1.38102 WP_003096331.1.38146 WP_003096331.1.38151 WP_003096331.1.38186 WP_003096331.1.38319 WP_003096331.1.3833 WP_003096331.1.38335 WP_003096331.1.38337 WP_003096331.1.38406 WP_003096331.1.38430 WP_003096331.1.38450 WP_003096331.1.38502 WP_003096331.1.38505 WP_003096331.1.38582 WP_003096331.1.38583 WP_003096331.1.38587 WP_003096331.1.38657 WP_003096331.1.38661 WP_003096331.1.3870 WP_003096331.1.38706 WP_003096331.1.38727 WP_003096331.1.38816 WP_003096331.1.38834 WP_003096331.1.38889 WP_003096331.1.38932 WP_003096331.1.38971 WP_003096331.1.39046 WP_003096331.1.39088 WP_003096331.1.39186 WP_003096331.1.39271 WP_003096331.1.39345 WP_003096331.1.3943 WP_003096331.1.39444 WP_003096331.1.39452 WP_003096331.1.39458 WP_003096331.1.39704 WP_003096331.1.39765 WP_003096331.1.39786 WP_003096331.1.39811 WP_003096331.1.39920 WP_003096331.1.39949 WP_003096331.1.3998 WP_003096331.1.40059 WP_003096331.1.40115 WP_003096331.1.40207 WP_003096331.1.40213 WP_003096331.1.40237 WP_003096331.1.40243 WP_003096331.1.40271 WP_003096331.1.4038 WP_003096331.1.40442 WP_003096331.1.40512 WP_003096331.1.40513 WP_003096331.1.40541 WP_003096331.1.40546 WP_003096331.1.4058 WP_003096331.1.40595 WP_003096331.1.40703 WP_003096331.1.40874 WP_003096331.1.40950 WP_003096331.1.40984 WP_003096331.1.40994 WP_003096331.1.41110 WP_003096331.1.41137 WP_003096331.1.41199 WP_003096331.1.41290 WP_003096331.1.41291 WP_003096331.1.41301 WP_003096331.1.41384 WP_003096331.1.41412 WP_003096331.1.41429 WP_003096331.1.41487 WP_003096331.1.41492 WP_003096331.1.41502 WP_003096331.1.4156 WP_003096331.1.41618 WP_003096331.1.41624 WP_003096331.1.41625 WP_003096331.1.41692 WP_003096331.1.41703 WP_003096331.1.41725 WP_003096331.1.41732 WP_003096331.1.41748 WP_003096331.1.41773 WP_003096331.1.41832 WP_003096331.1.41871 WP_003096331.1.41888 WP_003096331.1.4190 WP_003096331.1.41939 WP_003096331.1.4196 WP_003096331.1.42 WP_003096331.1.42019 WP_003096331.1.42041 WP_003096331.1.42047 WP_003096331.1.42146 WP_003096331.1.42259 WP_003096331.1.42294 WP_003096331.1.42316 WP_003096331.1.42381 WP_003096331.1.42388 WP_003096331.1.42411 WP_003096331.1.42423 WP_003096331.1.42463 WP_003096331.1.42499 WP_003096331.1.42508 WP_003096331.1.42634 WP_003096331.1.42643 WP_003096331.1.42690 WP_003096331.1.42696 WP_003096331.1.42723 WP_003096331.1.4273 WP_003096331.1.42754 WP_003096331.1.42757 WP_003096331.1.42778 WP_003096331.1.42789 WP_003096331.1.42854 WP_003096331.1.42856 WP_003096331.1.42870 WP_003096331.1.42917 WP_003096331.1.42946 WP_003096331.1.42952 WP_003096331.1.42972 WP_003096331.1.42973 WP_003096331.1.43024 WP_003096331.1.43026 WP_003096331.1.43106 WP_003096331.1.43107 WP_003096331.1.43212 WP_003096331.1.43245 WP_003096331.1.43286 WP_003096331.1.43293 WP_003096331.1.43315 WP_003096331.1.43326 WP_003096331.1.43330 WP_003096331.1.43356 WP_003096331.1.4348 WP_003096331.1.43593 WP_003096331.1.43603 WP_003096331.1.43662 WP_003096331.1.43667 WP_003096331.1.43673 WP_003096331.1.43696 WP_003096331.1.43729 WP_003096331.1.43756 WP_003096331.1.43783 WP_003096331.1.43802 WP_003096331.1.43811 WP_003096331.1.43826 WP_003096331.1.4398 WP_003096331.1.43998 WP_003096331.1.44046 WP_003096331.1.44094 WP_003096331.1.44213 WP_003096331.1.44260 WP_003096331.1.44269 WP_003096331.1.44373 WP_003096331.1.44434 WP_003096331.1.44486 WP_003096331.1.445 WP_003096331.1.44552 WP_003096331.1.44563 WP_003096331.1.44581 WP_003096331.1.44725 WP_003096331.1.44739 WP_003096331.1.44760 WP_003096331.1.44804 WP_003096331.1.44870 WP_003096331.1.4493 WP_003096331.1.44959 WP_003096331.1.45063 WP_003096331.1.45090 WP_003096331.1.45146 WP_003096331.1.45199 WP_003096331.1.45202 WP_003096331.1.4522 WP_003096331.1.45228 WP_003096331.1.45306 WP_003096331.1.45312 WP_003096331.1.4532 WP_003096331.1.45328 WP_003096331.1.45353 WP_003096331.1.45358 WP_003096331.1.45464 WP_003096331.1.45478 WP_003096331.1.45485 WP_003096331.1.45604 WP_003096331.1.45611 WP_003096331.1.45635 WP_003096331.1.45636 WP_003096331.1.45678 WP_003096331.1.45700 WP_003096331.1.45711 WP_003096331.1.45723 WP_003096331.1.45818 WP_003096331.1.45837 WP_003096331.1.45920 WP_003096331.1.45934 WP_003096331.1.45946 WP_003096331.1.45961 WP_003096331.1.46010 WP_003096331.1.46032 WP_003096331.1.46093 WP_003096331.1.461 WP_003096331.1.46152 WP_003096331.1.46306 WP_003096331.1.4640 WP_003096331.1.46436 WP_003096331.1.46502 WP_003096331.1.46623 WP_003096331.1.46633 WP_003096331.1.46755 WP_003096331.1.46787 WP_003096331.1.46826 WP_003096331.1.46846 WP_003096331.1.46866 WP_003096331.1.46885 WP_003096331.1.46926 WP_003096331.1.46935 WP_003096331.1.4699 WP_003096331.1.47101 WP_003096331.1.47150 WP_003096331.1.47155 WP_003096331.1.47158 WP_003096331.1.47251 WP_003096331.1.4726 WP_003096331.1.47296 WP_003096331.1.47312 WP_003096331.1.47374 WP_003096331.1.47469 WP_003096331.1.47480 WP_003096331.1.47527 WP_003096331.1.47551 WP_003096331.1.47598 WP_003096331.1.47645 WP_003096331.1.47774 WP_003096331.1.47930 WP_003096331.1.47934 WP_003096331.1.47970 WP_003096331.1.48001 WP_003096331.1.48024 WP_003096331.1.48086 WP_003096331.1.48094 WP_003096331.1.48141 WP_003096331.1.48172 WP_003096331.1.48178 WP_003096331.1.48321 WP_003096331.1.48334 WP_003096331.1.4836 WP_003096331.1.48378 WP_003096331.1.48382 WP_003096331.1.48413 WP_003096331.1.48472 WP_003096331.1.48487 WP_003096331.1.48545 WP_003096331.1.48546 WP_003096331.1.48576 WP_003096331.1.48579 WP_003096331.1.48747 WP_003096331.1.48810 WP_003096331.1.48820 WP_003096331.1.48840 WP_003096331.1.48842 WP_003096331.1.48851 WP_003096331.1.48870 WP_003096331.1.49108 WP_003096331.1.4913 WP_003096331.1.49244 WP_003096331.1.49265 WP_003096331.1.49266 WP_003096331.1.49277 WP_003096331.1.49286 WP_003096331.1.49293 WP_003096331.1.49360 WP_003096331.1.49416 WP_003096331.1.49500 WP_003096331.1.49557 WP_003096331.1.49566 WP_003096331.1.49688 WP_003096331.1.49798 WP_003096331.1.49806 WP_003096331.1.49833 WP_003096331.1.49922 WP_003096331.1.49976 WP_003096331.1.49988 WP_003096331.1.49998 WP_003096331.1.50176 WP_003096331.1.50180 WP_003096331.1.50222 WP_003096331.1.50232 WP_003096331.1.50242 WP_003096331.1.5043 WP_003096331.1.50450 WP_003096331.1.50459 WP_003096331.1.50567 WP_003096331.1.50653 WP_003096331.1.50665 WP_003096331.1.50668 WP_003096331.1.50682 WP_003096331.1.50691 WP_003096331.1.50734 WP_003096331.1.50783 WP_003096331.1.50814 WP_003096331.1.50922 WP_003096331.1.50967 WP_003096331.1.50989 WP_003096331.1.51019 WP_003096331.1.51035 WP_003096331.1.51136 WP_003096331.1.51173 WP_003096331.1.51185 WP_003096331.1.51273 WP_003096331.1.5132 WP_003096331.1.51457 WP_003096331.1.51472 WP_003096331.1.51501 WP_003096331.1.51538 WP_003096331.1.51549 WP_003096331.1.51682 WP_003096331.1.51727 WP_003096331.1.51733 WP_003096331.1.51807 WP_003096331.1.51847 WP_003096331.1.51917 WP_003096331.1.51928 WP_003096331.1.51937 WP_003096331.1.51943 WP_003096331.1.51957 WP_003096331.1.51976 WP_003096331.1.52043 WP_003096331.1.52146 WP_003096331.1.52152 WP_003096331.1.52212 WP_003096331.1.52220 WP_003096331.1.52244 WP_003096331.1.5226 WP_003096331.1.52334 WP_003096331.1.5235 WP_003096331.1.52355 WP_003096331.1.52372 WP_003096331.1.52403 WP_003096331.1.52409 WP_003096331.1.52500 WP_003096331.1.52537 WP_003096331.1.5258 WP_003096331.1.52583 WP_003096331.1.52591 WP_003096331.1.5260 WP_003096331.1.52690 WP_003096331.1.52697 WP_003096331.1.52700 WP_003096331.1.52728 WP_003096331.1.52784 WP_003096331.1.52790 WP_003096331.1.52810 WP_003096331.1.52850 WP_003096331.1.5289 WP_003096331.1.52939 WP_003096331.1.5294 WP_003096331.1.53037 WP_003096331.1.53038 WP_003096331.1.53070 WP_003096331.1.53072 WP_003096331.1.53169 WP_003096331.1.53267 WP_003096331.1.53287 WP_003096331.1.53351 WP_003096331.1.53371 WP_003096331.1.53414 WP_003096331.1.53427 WP_003096331.1.53486 WP_003096331.1.53528 WP_003096331.1.53530 WP_003096331.1.53586 WP_003096331.1.53663 WP_003096331.1.53678 WP_003096331.1.53719 WP_003096331.1.53726 WP_003096331.1.53826 WP_003096331.1.5388 WP_003096331.1.53932 WP_003096331.1.53946 WP_003096331.1.53948 WP_003096331.1.53951 WP_003096331.1.54003 WP_003096331.1.54076 WP_003096331.1.54090 WP_003096331.1.54133 WP_003096331.1.54140 WP_003096331.1.54146 WP_003096331.1.5420 WP_003096331.1.54248 WP_003096331.1.5427 WP_003096331.1.54293 WP_003096331.1.54354 WP_003096331.1.54462 WP_003096331.1.54497 WP_003096331.1.54571 WP_003096331.1.54742 WP_003096331.1.54809 WP_003096331.1.54974 WP_003096331.1.55 WP_003096331.1.55089 WP_003096331.1.55169 WP_003096331.1.55318 WP_003096331.1.55347 WP_003096331.1.55387 WP_003096331.1.55400 WP_003096331.1.55445 WP_003096331.1.55478 WP_003096331.1.55543 WP_003096331.1.55813 WP_003096331.1.56013 WP_003096331.1.56037 WP_003096331.1.56145 WP_003096331.1.56171 WP_003096331.1.56187 WP_003096331.1.56196 WP_003096331.1.56229 WP_003096331.1.56315 WP_003096331.1.56348 WP_003096331.1.56442 WP_003096331.1.56452 WP_003096331.1.56474 WP_003096331.1.56475 WP_003096331.1.56626 WP_003096331.1.56632 WP_003096331.1.56745 WP_003096331.1.56768 WP_003096331.1.56797 WP_003096331.1.56808 WP_003096331.1.56819 WP_003096331.1.56864 WP_003096331.1.56896 WP_003096331.1.57005 WP_003096331.1.57020 WP_003096331.1.57065 WP_003096331.1.57113 WP_003096331.1.57140 WP_003096331.1.57276 WP_003096331.1.5731 WP_003096331.1.57339 WP_003096331.1.57369 WP_003096331.1.57417 WP_003096331.1.57460 WP_003096331.1.57477 WP_003096331.1.57480 WP_003096331.1.57532 WP_003096331.1.57548 WP_003096331.1.57566 WP_003096331.1.57728 WP_003096331.1.57839 WP_003096331.1.57853 WP_003096331.1.57921 WP_003096331.1.58019 WP_003096331.1.58056 WP_003096331.1.58155 WP_003096331.1.58162 WP_003096331.1.58183 WP_003096331.1.58193 WP_003096331.1.58200 WP_003096331.1.58228 WP_003096331.1.58294 WP_003096331.1.58360 WP_003096331.1.58436 WP_003096331.1.58482 WP_003096331.1.58510 WP_003096331.1.5856 WP_003096331.1.58581 WP_003096331.1.58689 WP_003096331.1.5869 WP_003096331.1.58785 WP_003096331.1.58800 WP_003096331.1.58838 WP_003096331.1.58845 WP_003096331.1.58944 WP_003096331.1.58952 WP_003096331.1.5897 WP_003096331.1.59013 WP_003096331.1.59076 WP_003096331.1.59123 WP_003096331.1.59156 WP_003096331.1.59158 WP_003096331.1.59176 WP_003096331.1.59246 WP_003096331.1.59249 WP_003096331.1.59250 WP_003096331.1.59288 WP_003096331.1.59339 WP_003096331.1.5937 WP_003096331.1.59376 WP_003096331.1.59385 WP_003096331.1.594 WP_003096331.1.59469 WP_003096331.1.59563 WP_003096331.1.59688 WP_003096331.1.59724 WP_003096331.1.59759 WP_003096331.1.59797 WP_003096331.1.59831 WP_003096331.1.59870 WP_003096331.1.59943 WP_003096331.1.60051 WP_003096331.1.60062 WP_003096331.1.60079 WP_003096331.1.60082 WP_003096331.1.60084 WP_003096331.1.60085 WP_003096331.1.60347 WP_003096331.1.60364 WP_003096331.1.60415 WP_003096331.1.60467 WP_003096331.1.60472 WP_003096331.1.60509 WP_003096331.1.60600 WP_003096331.1.60602 WP_003096331.1.60603 WP_003096331.1.60639 WP_003096331.1.60679 WP_003096331.1.60686 WP_003096331.1.60850 WP_003096331.1.60910 WP_003096331.1.60916 WP_003096331.1.60970 WP_003096331.1.60979 WP_003096331.1.61122 WP_003096331.1.61130 WP_003096331.1.61191 WP_003096331.1.61209 WP_003096331.1.61222 WP_003096331.1.61269 WP_003096331.1.61288 WP_003096331.1.61299 WP_003096331.1.6130 WP_003096331.1.61366 WP_003096331.1.61431 WP_003096331.1.61493 WP_003096331.1.61549 WP_003096331.1.61589 WP_003096331.1.61598 WP_003096331.1.616 WP_003096331.1.61696 WP_003096331.1.6173 WP_003096331.1.62010 WP_003096331.1.62035 WP_003096331.1.62211 WP_003096331.1.62263 WP_003096331.1.62357 WP_003096331.1.62396 WP_003096331.1.62410 WP_003096331.1.6242 WP_003096331.1.62483 WP_003096331.1.62516 WP_003096331.1.62534 WP_003096331.1.626 WP_003096331.1.62635 WP_003096331.1.62688 WP_003096331.1.62701 WP_003096331.1.62703 WP_003096331.1.62704 WP_003096331.1.62708 WP_003096331.1.62716 WP_003096331.1.62768 WP_003096331.1.62772 WP_003096331.1.6280 WP_003096331.1.6283 WP_003096331.1.62834 WP_003096331.1.62838 WP_003096331.1.62873 WP_003096331.1.62917 WP_003096331.1.62961 WP_003096331.1.62977 WP_003096331.1.63038 WP_003096331.1.63041 WP_003096331.1.63057 WP_003096331.1.63193 WP_003096331.1.63196 WP_003096331.1.63338 WP_003096331.1.63369 WP_003096331.1.63591 WP_003096331.1.63597 WP_003096331.1.63634 WP_003096331.1.63659 WP_003096331.1.63739 WP_003096331.1.63929 WP_003096331.1.63941 WP_003096331.1.63995 WP_003096331.1.64139 WP_003096331.1.64155 WP_003096331.1.64198 WP_003096331.1.64212 WP_003096331.1.64309 WP_003096331.1.64329 WP_003096331.1.64340 WP_003096331.1.64433 WP_003096331.1.6450 WP_003096331.1.64544 WP_003096331.1.64603 WP_003096331.1.64605 WP_003096331.1.6461 WP_003096331.1.64611 WP_003096331.1.64726 WP_003096331.1.64748 WP_003096331.1.64799 WP_003096331.1.64807 WP_003096331.1.64854 WP_003096331.1.64862 WP_003096331.1.64880 WP_003096331.1.64885 WP_003096331.1.64886 WP_003096331.1.64983 WP_003096331.1.64984 WP_003096331.1.65009 WP_003096331.1.65066 WP_003096331.1.65092 WP_003096331.1.65095 WP_003096331.1.65099 WP_003096331.1.65145 WP_003096331.1.65196 WP_003096331.1.65197 WP_003096331.1.65227 WP_003096331.1.65237 WP_003096331.1.65247 WP_003096331.1.65304 WP_003096331.1.65312 WP_003096331.1.65316 WP_003096331.1.65334 WP_003096331.1.65335 WP_003096331.1.65337 WP_003096331.1.65457 WP_003096331.1.65478 WP_003096331.1.65549 WP_003096331.1.65588 WP_003096331.1.65632 WP_003096331.1.65642 WP_003096331.1.65679 WP_003096331.1.65740 WP_003096331.1.65779 WP_003096331.1.65819 WP_003096331.1.65867 WP_003096331.1.6589 WP_003096331.1.65926 WP_003096331.1.66062 WP_003096331.1.66088 WP_003096331.1.66155 WP_003096331.1.66165 WP_003096331.1.6627 WP_003096331.1.66277 WP_003096331.1.6629 WP_003096331.1.66345 WP_003096331.1.66348 WP_003096331.1.66364 WP_003096331.1.66371 WP_003096331.1.66410 WP_003096331.1.66526 WP_003096331.1.66563 WP_003096331.1.66634 WP_003096331.1.66693 WP_003096331.1.66721 WP_003096331.1.66892 WP_003096331.1.66929 WP_003096331.1.66950 WP_003096331.1.67010 WP_003096331.1.67124 WP_003096331.1.67188 WP_003096331.1.67192 WP_003096331.1.67205 WP_003096331.1.67261 WP_003096331.1.67269 WP_003096331.1.6734 WP_003096331.1.67370 WP_003096331.1.67388 WP_003096331.1.67472 WP_003096331.1.67489 WP_003096331.1.67526 WP_003096331.1.67531 WP_003096331.1.67545 WP_003096331.1.6768 WP_003096331.1.67686 WP_003096331.1.67755 WP_003096331.1.67830 WP_003096331.1.67874 WP_003096331.1.67875 WP_003096331.1.67937 WP_003096331.1.67948 WP_003096331.1.6796 WP_003096331.1.68000 WP_003096331.1.6808 WP_003096331.1.68162 WP_003096331.1.68172 WP_003096331.1.68183 WP_003096331.1.68252 WP_003096331.1.68317 WP_003096331.1.68446 WP_003096331.1.68448 WP_003096331.1.68472 WP_003096331.1.68499 WP_003096331.1.6850 WP_003096331.1.68541 WP_003096331.1.68561 WP_003096331.1.68568 WP_003096331.1.68638 WP_003096331.1.6866 WP_003096331.1.68756 WP_003096331.1.68781 WP_003096331.1.68790 WP_003096331.1.68800 WP_003096331.1.68802 WP_003096331.1.68850 WP_003096331.1.68857 WP_003096331.1.68862 WP_003096331.1.68881 WP_003096331.1.68910 WP_003096331.1.68938 WP_003096331.1.68979 WP_003096331.1.69088 WP_003096331.1.6911 WP_003096331.1.69159 WP_003096331.1.69209 WP_003096331.1.69260 WP_003096331.1.6928 WP_003096331.1.6931 WP_003096331.1.69330 WP_003096331.1.6937 WP_003096331.1.69411 WP_003096331.1.69534 WP_003096331.1.69556 WP_003096331.1.69599 WP_003096331.1.69702 WP_003096331.1.69788 WP_003096331.1.69791 WP_003096331.1.69819 WP_003096331.1.69834 WP_003096331.1.69907 WP_003096331.1.69993 WP_003096331.1.70092 WP_003096331.1.70098 WP_003096331.1.70138 WP_003096331.1.70168 WP_003096331.1.70194 WP_003096331.1.70216 WP_003096331.1.70229 WP_003096331.1.70331 WP_003096331.1.70460 WP_003096331.1.70470 WP_003096331.1.70537 WP_003096331.1.70561 WP_003096331.1.70583 WP_003096331.1.70648 WP_003096331.1.70650 WP_003096331.1.70670 WP_003096331.1.70693 WP_003096331.1.7077 WP_003096331.1.70778 WP_003096331.1.70831 WP_003096331.1.70991 WP_003096331.1.71038 WP_003096331.1.71141 WP_003096331.1.71203 WP_003096331.1.71234 WP_003096331.1.71249 WP_003096331.1.71254 WP_003096331.1.7128 WP_003096331.1.71290 WP_003096331.1.71346 WP_003096331.1.71385 WP_003096331.1.71412 WP_003096331.1.71570 WP_003096331.1.71610 WP_003096331.1.7163 WP_003096331.1.71642 WP_003096331.1.71666 WP_003096331.1.71799 WP_003096331.1.71806 WP_003096331.1.71822 WP_003096331.1.71866 WP_003096331.1.71891 WP_003096331.1.71927 WP_003096331.1.72149 WP_003096331.1.72167 WP_003096331.1.72181 WP_003096331.1.72183 WP_003096331.1.72287 WP_003096331.1.72323 WP_003096331.1.72331 WP_003096331.1.72346 WP_003096331.1.72378 WP_003096331.1.72447 WP_003096331.1.72458 WP_003096331.1.72477 WP_003096331.1.72541 WP_003096331.1.72562 WP_003096331.1.72653 WP_003096331.1.72662 WP_003096331.1.72669 WP_003096331.1.72727 WP_003096331.1.7276 WP_003096331.1.72768 WP_003096331.1.72772 WP_003096331.1.72782 WP_003096331.1.72845 WP_003096331.1.72920 WP_003096331.1.73035 WP_003096331.1.73048 WP_003096331.1.7308 WP_003096331.1.73135 WP_003096331.1.73149 WP_003096331.1.73172 WP_003096331.1.73192 WP_003096331.1.7327 WP_003096331.1.7329 WP_003096331.1.733 WP_003096331.1.73455 WP_003096331.1.73490 WP_003096331.1.73523 WP_003096331.1.73601 WP_003096331.1.73651 WP_003096331.1.73719 WP_003096331.1.73791 WP_003096331.1.7382 WP_003096331.1.73860 WP_003096331.1.73889 WP_003096331.1.73911 WP_003096331.1.74 WP_003096331.1.74000 WP_003096331.1.74072 WP_003096331.1.74074 WP_003096331.1.7408 WP_003096331.1.74106 WP_003096331.1.74167 WP_003096331.1.74175 WP_003096331.1.74180 WP_003096331.1.74182 WP_003096331.1.74219 WP_003096331.1.74264 WP_003096331.1.74268 WP_003096331.1.74281 WP_003096331.1.74287 WP_003096331.1.74326 WP_003096331.1.7445 WP_003096331.1.74458 WP_003096331.1.74473 WP_003096331.1.74475 WP_003096331.1.74518 WP_003096331.1.7456 WP_003096331.1.74568 WP_003096331.1.74604 WP_003096331.1.74629 WP_003096331.1.74637 WP_003096331.1.74685 WP_003096331.1.74772 WP_003096331.1.74776 WP_003096331.1.748 WP_003096331.1.74878 WP_003096331.1.74941 WP_003096331.1.74948 WP_003096331.1.74958 WP_003096331.1.7501 WP_003096331.1.75041 WP_003096331.1.75119 WP_003096331.1.75204 WP_003096331.1.75277 WP_003096331.1.75303 WP_003096331.1.75389 WP_003096331.1.75431 WP_003096331.1.7547 WP_003096331.1.75549 WP_003096331.1.75573 WP_003096331.1.75599 WP_003096331.1.75603 WP_003096331.1.75631 WP_003096331.1.7568 WP_003096331.1.75756 WP_003096331.1.75771 WP_003096331.1.75792 WP_003096331.1.75825 WP_003096331.1.75826 WP_003096331.1.75860 WP_003096331.1.75935 WP_003096331.1.75938 WP_003096331.1.75947 WP_003096331.1.7595 WP_003096331.1.76077 WP_003096331.1.76092 WP_003096331.1.76141 WP_003096331.1.76145 WP_003096331.1.76192 WP_003096331.1.76322 WP_003096331.1.76355 WP_003096331.1.76383 WP_003096331.1.76399 WP_003096331.1.76441 WP_003096331.1.76467 WP_003096331.1.76543 WP_003096331.1.76600 WP_003096331.1.76633 WP_003096331.1.7666 WP_003096331.1.76716 WP_003096331.1.76775 WP_003096331.1.76791 WP_003096331.1.76861 WP_003096331.1.76922 WP_003096331.1.76985 WP_003096331.1.77235 WP_003096331.1.77238 WP_003096331.1.77286 WP_003096331.1.77317 WP_003096331.1.77442 WP_003096331.1.77476 WP_003096331.1.77490 WP_003096331.1.77574 WP_003096331.1.77686 WP_003096331.1.77750 WP_003096331.1.77769 WP_003096331.1.77819 WP_003096331.1.77834 WP_003096331.1.77913 WP_003096331.1.78104 WP_003096331.1.78112 WP_003096331.1.78118 WP_003096331.1.78134 WP_003096331.1.78148 WP_003096331.1.78158 WP_003096331.1.78280 WP_003096331.1.78288 WP_003096331.1.78380 WP_003096331.1.7840 WP_003096331.1.78409 WP_003096331.1.78425 WP_003096331.1.78430 WP_003096331.1.78437 WP_003096331.1.78570 WP_003096331.1.78599 WP_003096331.1.78623 WP_003096331.1.78669 WP_003096331.1.78693 WP_003096331.1.78795 WP_003096331.1.788 WP_003096331.1.78810 WP_003096331.1.78926 WP_003096331.1.78947 WP_003096331.1.78954 WP_003096331.1.78986 WP_003096331.1.7899 WP_003096331.1.79003 WP_003096331.1.79007 WP_003096331.1.79053 WP_003096331.1.79060 WP_003096331.1.79177 WP_003096331.1.79193 WP_003096331.1.79256 WP_003096331.1.79279 WP_003096331.1.79286 WP_003096331.1.79311 WP_003096331.1.79357 WP_003096331.1.79364 WP_003096331.1.79421 WP_003096331.1.79429 WP_003096331.1.79431 WP_003096331.1.7945 WP_003096331.1.79463 WP_003096331.1.79507 WP_003096331.1.7953 WP_003096331.1.79544 WP_003096331.1.79569 WP_003096331.1.79601 WP_003096331.1.79631 WP_003096331.1.79699 WP_003096331.1.79754 WP_003096331.1.79788 WP_003096331.1.79862 WP_003096331.1.79883 WP_003096331.1.799 WP_003096331.1.79902 WP_003096331.1.79908 WP_003096331.1.79986 WP_003096331.1.8 WP_003096331.1.80033 WP_003096331.1.80068 WP_003096331.1.80087 WP_003096331.1.80102 WP_003096331.1.8013 WP_003096331.1.80174 WP_003096331.1.80258 WP_003096331.1.8028 WP_003096331.1.80306 WP_003096331.1.8038 WP_003096331.1.80410 WP_003096331.1.80411 WP_003096331.1.80454 WP_003096331.1.80481 WP_003096331.1.8051 WP_003096331.1.80535 WP_003096331.1.80627 WP_003096331.1.80632 WP_003096331.1.8064 WP_003096331.1.80644 WP_003096331.1.80645 WP_003096331.1.80683 WP_003096331.1.80715 WP_003096331.1.80720 WP_003096331.1.80785 WP_003096331.1.80846 WP_003096331.1.80880 WP_003096331.1.80892 WP_003096331.1.80910 WP_003096331.1.80926 WP_003096331.1.80929 WP_003096331.1.80931 WP_003096331.1.80938 WP_003096331.1.80969 WP_003096331.1.81081 WP_003096331.1.81082 WP_003096331.1.8110 WP_003096331.1.81206 WP_003096331.1.81237 WP_003096331.1.81331 WP_003096331.1.81338 WP_003096331.1.81349 WP_003096331.1.81380 WP_003096331.1.8141 WP_003096331.1.81426 WP_003096331.1.81470 WP_003096331.1.81482 WP_003096331.1.81487 WP_003096331.1.81591 WP_003096331.1.81622 WP_003096331.1.81643 WP_003096331.1.81728 WP_003096331.1.81742 WP_003096331.1.81748 WP_003096331.1.81771 WP_003096331.1.81784 WP_003096331.1.81802 WP_003096331.1.81816 WP_003096331.1.81834 WP_003096331.1.81844 WP_003096331.1.81856 WP_003096331.1.81874 WP_003096331.1.81927 WP_003096331.1.81950 WP_003096331.1.81957 WP_003096331.1.81960 WP_003096331.1.82117 WP_003096331.1.82178 WP_003096331.1.82260 WP_003096331.1.8227 WP_003096331.1.82310 WP_003096331.1.82312 WP_003096331.1.82328 WP_003096331.1.82334 WP_003096331.1.8238 WP_003096331.1.82442 WP_003096331.1.82487 WP_003096331.1.82580 WP_003096331.1.82604 WP_003096331.1.82606 WP_003096331.1.82620 WP_003096331.1.82643 WP_003096331.1.82686 WP_003096331.1.82710 WP_003096331.1.82798 WP_003096331.1.82810 WP_003096331.1.8284 WP_003096331.1.82864 WP_003096331.1.82882 WP_003096331.1.82887 WP_003096331.1.83025 WP_003096331.1.83131 WP_003096331.1.83184 WP_003096331.1.83213 WP_003096331.1.83251 WP_003096331.1.83267 WP_003096331.1.83296 WP_003096331.1.83317 WP_003096331.1.83374 WP_003096331.1.83394 WP_003096331.1.83440 WP_003096331.1.83460 WP_003096331.1.83463 WP_003096331.1.835 WP_003096331.1.83503 WP_003096331.1.8351 WP_003096331.1.8353 WP_003096331.1.83534 WP_003096331.1.83540 WP_003096331.1.8357 WP_003096331.1.83637 WP_003096331.1.83698 WP_003096331.1.83715 WP_003096331.1.83871 WP_003096331.1.83937 WP_003096331.1.83946 WP_003096331.1.84003 WP_003096331.1.84008 WP_003096331.1.84138 WP_003096331.1.84162 WP_003096331.1.84174 WP_003096331.1.84177 WP_003096331.1.84178 WP_003096331.1.84190 WP_003096331.1.84203 WP_003096331.1.84271 WP_003096331.1.84297 WP_003096331.1.84374 WP_003096331.1.84398 WP_003096331.1.84439 WP_003096331.1.84471 WP_003096331.1.84487 WP_003096331.1.84526 WP_003096331.1.8453 WP_003096331.1.84558 WP_003096331.1.84589 WP_003096331.1.84674 WP_003096331.1.84684 WP_003096331.1.84702 WP_003096331.1.84715 WP_003096331.1.84754 WP_003096331.1.84792 WP_003096331.1.84825 WP_003096331.1.8484 WP_003096331.1.84865 WP_003096331.1.84937 WP_003096331.1.8498 WP_003096331.1.85018 WP_003096331.1.85028 WP_003096331.1.85059 WP_003096331.1.85150 WP_003096331.1.85220 WP_003096331.1.85290 WP_003096331.1.85298 WP_003096331.1.85303 WP_003096331.1.85311 WP_003096331.1.85318 WP_003096331.1.85357 WP_003096331.1.85446 WP_003096331.1.85574 WP_003096331.1.85633 WP_003096331.1.85638 WP_003096331.1.85788 WP_003096331.1.85897 WP_003096331.1.85910 WP_003096331.1.85920 WP_003096331.1.85978 WP_003096331.1.86002 WP_003096331.1.86047 WP_003096331.1.86055 WP_003096331.1.86058 WP_003096331.1.86125 WP_003096331.1.86182 WP_003096331.1.86243 WP_003096331.1.86278 WP_003096331.1.86287 WP_003096331.1.86293 WP_003096331.1.86386 WP_003096331.1.8645 WP_003096331.1.865 WP_003096331.1.86506 WP_003096331.1.86545 WP_003096331.1.86552 WP_003096331.1.86554 WP_003096331.1.86595 WP_003096331.1.86652 WP_003096331.1.86665 WP_003096331.1.867 WP_003096331.1.86774 WP_003096331.1.86780 WP_003096331.1.86785 WP_003096331.1.86796 WP_003096331.1.86813 WP_003096331.1.86822 WP_003096331.1.8693 WP_003096331.1.86947 WP_003096331.1.86970 WP_003096331.1.86985 WP_003096331.1.87104 WP_003096331.1.87163 WP_003096331.1.8718 WP_003096331.1.87182 WP_003096331.1.8727 WP_003096331.1.87316 WP_003096331.1.87390 WP_003096331.1.87435 WP_003096331.1.87463 WP_003096331.1.8749 WP_003096331.1.87530 WP_003096331.1.87547 WP_003096331.1.87648 WP_003096331.1.87763 WP_003096331.1.8777 WP_003096331.1.8785 WP_003096331.1.87877 WP_003096331.1.87888 WP_003096331.1.87970 WP_003096331.1.87975 WP_003096331.1.87981 WP_003096331.1.87987 WP_003096331.1.88004 WP_003096331.1.88308 WP_003096331.1.88330 WP_003096331.1.88360 WP_003096331.1.88388 WP_003096331.1.88517 WP_003096331.1.8852 WP_003096331.1.88540 WP_003096331.1.88550 WP_003096331.1.88578 WP_003096331.1.88605 WP_003096331.1.88659 WP_003096331.1.88679 WP_003096331.1.88680 WP_003096331.1.88714 WP_003096331.1.88750 WP_003096331.1.88796 WP_003096331.1.889 WP_003096331.1.88900 WP_003096331.1.88969 WP_003096331.1.89083 WP_003096331.1.89098 WP_003096331.1.8911 WP_003096331.1.89245 WP_003096331.1.89276 WP_003096331.1.89409 WP_003096331.1.89434 WP_003096331.1.89440 WP_003096331.1.89480 WP_003096331.1.89491 WP_003096331.1.89523 WP_003096331.1.89577 WP_003096331.1.89610 WP_003096331.1.89662 WP_003096331.1.89669 WP_003096331.1.89736 WP_003096331.1.8976 WP_003096331.1.89776 WP_003096331.1.89805 WP_003096331.1.89866 WP_003096331.1.89867 WP_003096331.1.89868 WP_003096331.1.89886 WP_003096331.1.89992 WP_003096331.1.90056 WP_003096331.1.90110 WP_003096331.1.90141 WP_003096331.1.90150 WP_003096331.1.90189 WP_003096331.1.90224 WP_003096331.1.90225 WP_003096331.1.90242 WP_003096331.1.90268 WP_003096331.1.90272 WP_003096331.1.90306 WP_003096331.1.90412 WP_003096331.1.9056 WP_003096331.1.90569 WP_003096331.1.90655 WP_003096331.1.90770 WP_003096331.1.90940 WP_003096331.1.90999 WP_003096331.1.91012 WP_003096331.1.91093 WP_003096331.1.91161 WP_003096331.1.9120 WP_003096331.1.91204 WP_003096331.1.91236 WP_003096331.1.91281 WP_003096331.1.91336 WP_003096331.1.91360 WP_003096331.1.91392 WP_003096331.1.91416 WP_003096331.1.9143 WP_003096331.1.91431 WP_003096331.1.91438 WP_003096331.1.91467 WP_003096331.1.91563 WP_003096331.1.91585 WP_003096331.1.91796 WP_003096331.1.91803 WP_003096331.1.9182 WP_003096331.1.91838 WP_003096331.1.91846 WP_003096331.1.91860 WP_003096331.1.91862 WP_003096331.1.91882 WP_003096331.1.9191 WP_003096331.1.91938 WP_003096331.1.91943 WP_003096331.1.91996 WP_003096331.1.92175 WP_003096331.1.9219 WP_003096331.1.92314 WP_003096331.1.92321 WP_003096331.1.92357 WP_003096331.1.92454 WP_003096331.1.92573 WP_003096331.1.92585 WP_003096331.1.92587 WP_003096331.1.92589 WP_003096331.1.92594 WP_003096331.1.92624 WP_003096331.1.92630 WP_003096331.1.92642 WP_003096331.1.9272 WP_003096331.1.92759 WP_003096331.1.92769 WP_003096331.1.92839 WP_003096331.1.92847 WP_003096331.1.92924 WP_003096331.1.92930 WP_003096331.1.93001 WP_003096331.1.93122 WP_003096331.1.93130 WP_003096331.1.93144 WP_003096331.1.93148 WP_003096331.1.93196 WP_003096331.1.93250 WP_003096331.1.93264 WP_003096331.1.9328 WP_003096331.1.93446 WP_003096331.1.9349 WP_003096331.1.93493 WP_003096331.1.93498 WP_003096331.1.93520 WP_003096331.1.93547 WP_003096331.1.93562 WP_003096331.1.93568 WP_003096331.1.93797 WP_003096331.1.93848 WP_003096331.1.93889 WP_003096331.1.94004 WP_003096331.1.94031 WP_003096331.1.94065 WP_003096331.1.94078 WP_003096331.1.94136 WP_003096331.1.94174 WP_003096331.1.94211 WP_003096331.1.94218 WP_003096331.1.94221 WP_003096331.1.94243 WP_003096331.1.94285 WP_003096331.1.94288 WP_003096331.1.94333 WP_003096331.1.94349 WP_003096331.1.94385 WP_003096331.1.94434 WP_003096331.1.9444 WP_003096331.1.94682 WP_003096331.1.94732 WP_003096331.1.94742 WP_003096331.1.94814 WP_003096331.1.94818 WP_003096331.1.94856 WP_003096331.1.94874 WP_003096331.1.94881 WP_003096331.1.94896 WP_003096331.1.95018 WP_003096331.1.95025 WP_003096331.1.95027 WP_003096331.1.95056 WP_003096331.1.95117 WP_003096331.1.95132 WP_003096331.1.95187 WP_003096331.1.95207 WP_003096331.1.95217 WP_003096331.1.95305 WP_003096331.1.95354 WP_003096331.1.95359 WP_003096331.1.95460 WP_003096331.1.95488 WP_003096331.1.95525 WP_003096331.1.95536 WP_003096331.1.95638 WP_003096331.1.95668 WP_003096331.1.95745 WP_003096331.1.95751 WP_003096331.1.95774 WP_003096331.1.95782 WP_003096331.1.95802 WP_003096331.1.95820 WP_003096331.1.95825 WP_003096331.1.95959 WP_003096331.1.9599 WP_003096331.1.95994 WP_003096331.1.95999 WP_003096331.1.96008 WP_003096331.1.9604 WP_003096331.1.96041 WP_003096331.1.96058 WP_003096331.1.961 WP_003096331.1.96193 WP_003096331.1.96243 WP_003096331.1.96267 WP_003096331.1.96357 WP_003096331.1.96384 WP_003096331.1.96434 WP_003096331.1.96452 WP_003096331.1.96506 WP_003096331.1.96702 WP_003096331.1.96714 WP_003096331.1.96863 WP_003096331.1.96967 WP_003096331.1.9706 WP_003096331.1.97118 WP_003096331.1.97126 WP_003096331.1.97204 WP_003096331.1.97213 WP_003096331.1.9722 WP_003096331.1.97271 WP_003096331.1.97272 WP_003096331.1.97377 WP_003096331.1.97461 WP_003096331.1.97474 WP_003096331.1.97488 WP_003096331.1.97499 WP_003096331.1.97503 WP_003096331.1.97521 WP_003096331.1.97583 WP_003096331.1.97614 WP_003096331.1.977 WP_003096331.1.97784 WP_003096331.1.97826 WP_003096331.1.97877 WP_003096331.1.97968 WP_003096331.1.98260 WP_003096331.1.98276 WP_003096331.1.98410 WP_003096331.1.98414 WP_003096331.1.98433 WP_003096331.1.9845 WP_003096331.1.985 WP_003096331.1.98515 WP_003096331.1.98522 WP_003096331.1.98573 WP_003096331.1.98600 WP_003096331.1.98610 WP_003096331.1.98672 WP_003096331.1.98678 WP_003096331.1.98693 WP_003096331.1.98718 WP_003096331.1.98788 WP_003096331.1.9885 WP_003096331.1.98873 WP_003096331.1.98907 WP_003096331.1.98926 WP_003096331.1.98960 WP_003096331.1.98963 WP_003096331.1.99065 WP_003096331.1.99068 WP_003096331.1.99103 WP_003096331.1.99293 WP_003096331.1.99378 WP_003096331.1.99386 WP_003096331.1.99389 WP_003096331.1.99443 WP_003096331.1.99461 WP_003096331.1.99516 WP_003096331.1.99647 WP_003096331.1.99654 WP_003096331.1.99662 WP_003096331.1.99746 WP_003096331.1.99757 WP_003096331.1.99772 WP_003096331.1.99795 WP_003096331.1.99835 WP_003096331.1.9989 WP_003096331.1.99930 208963.PA14_69140 208964.PA5236 557722.PLES_56301 gi|568156764|ref|YP_008945757.1| gi|392986917|ref|YP_006485504.1| gi|558669078|ref|YP_008805788.1| gi|15600429|ref|NP_253923.1| gi|116053383|ref|YP_793708.1| gi|218894338|ref|YP_002443208.1| gi|514412349|ref|YP_008135894.1| gi|478481691|ref|YP_007712342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]