SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156942|ref|YP_008945935.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156942|ref|YP_008945935.1|
Domain Number 1 Region: 108-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-37
Family Flavohemoglobin, C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.86e-29
Family Ferredoxin reductase FAD-binding domain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 243-365
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.6e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156942|ref|YP_008945935.1|
Sequence length 366
Comment ferredoxin [Pseudomonas aeruginosa LES431]
Sequence
MSSNFLNPVTTQTWANGRHLVRCVKVIQETWDVRTFCFMADQPILFFFKPGQFVTLELEI
DGEPVMRSYTISSSPSVPYSFSITIKRVPGGRVSNWLHDNLKEGQELPVHGPVGLFNAID
FPADKVLFLSGGVGITPVMSMARWFFDTNANVDMVFVHSARSPKDIIYHRELEHMASRID
NFSLHIICERHGLGEAWAGYRGYLNLRMLELIAPDFLEREIFCCGPTPYMSAVKHLLQGH
GYDMSRYHEEAFGPTPPEVRADVRELAAEAAEAPEVPVADQHQVEFTATGKSIRVSPGET
VHAAAAKLGLHIPKACGMGICGTCKVMKTAGEVEMEHNGGITDEDVAEGYILSCCSVPKG
DVVIDY
Download sequence
Identical sequences A0A072ZFE6 A0A086BUI4 A0A0E1B2C7 A0A0H2ZJB2 A0A0H3QRJ1 A0A157WGL2 A0A1C7BCH0 A0A1E9BZ87 A0A1F0IIE6 A0A1G5LQ05 A6VEM5 Q9HTF3 V6AP43
gi|116053559|ref|YP_793886.1| gi|386069069|ref|YP_005984373.1| gi|392987135|ref|YP_006485722.1| gi|568312868|ref|YP_008985137.1| NP_254098.1.87394 WP_003096769.1.100071 WP_003096769.1.100179 WP_003096769.1.100276 WP_003096769.1.100278 WP_003096769.1.100319 WP_003096769.1.100394 WP_003096769.1.100420 WP_003096769.1.100456 WP_003096769.1.100469 WP_003096769.1.100473 WP_003096769.1.100476 WP_003096769.1.100523 WP_003096769.1.100654 WP_003096769.1.100723 WP_003096769.1.100742 WP_003096769.1.100777 WP_003096769.1.100786 WP_003096769.1.100808 WP_003096769.1.100809 WP_003096769.1.100810 WP_003096769.1.100872 WP_003096769.1.100983 WP_003096769.1.100995 WP_003096769.1.101021 WP_003096769.1.101047 WP_003096769.1.101269 WP_003096769.1.101310 WP_003096769.1.101340 WP_003096769.1.101506 WP_003096769.1.101572 WP_003096769.1.101590 WP_003096769.1.101642 WP_003096769.1.101712 WP_003096769.1.101739 WP_003096769.1.10174 WP_003096769.1.101781 WP_003096769.1.10179 WP_003096769.1.101809 WP_003096769.1.101819 WP_003096769.1.10185 WP_003096769.1.101863 WP_003096769.1.101871 WP_003096769.1.10201 WP_003096769.1.10204 WP_003096769.1.102045 WP_003096769.1.10248 WP_003096769.1.10257 WP_003096769.1.10271 WP_003096769.1.10407 WP_003096769.1.10419 WP_003096769.1.10435 WP_003096769.1.10457 WP_003096769.1.10468 WP_003096769.1.10477 WP_003096769.1.10482 WP_003096769.1.10513 WP_003096769.1.10529 WP_003096769.1.10548 WP_003096769.1.10572 WP_003096769.1.10575 WP_003096769.1.10636 WP_003096769.1.10641 WP_003096769.1.10684 WP_003096769.1.10764 WP_003096769.1.10856 WP_003096769.1.10895 WP_003096769.1.10901 WP_003096769.1.10949 WP_003096769.1.11026 WP_003096769.1.11058 WP_003096769.1.1107 WP_003096769.1.11077 WP_003096769.1.1109 WP_003096769.1.11130 WP_003096769.1.11163 WP_003096769.1.11178 WP_003096769.1.11180 WP_003096769.1.11318 WP_003096769.1.11381 WP_003096769.1.11388 WP_003096769.1.11410 WP_003096769.1.11417 WP_003096769.1.11568 WP_003096769.1.11569 WP_003096769.1.11653 WP_003096769.1.11744 WP_003096769.1.1180 WP_003096769.1.1183 WP_003096769.1.11847 WP_003096769.1.11854 WP_003096769.1.1187 WP_003096769.1.11943 WP_003096769.1.12018 WP_003096769.1.12081 WP_003096769.1.12120 WP_003096769.1.12150 WP_003096769.1.12200 WP_003096769.1.12208 WP_003096769.1.12240 WP_003096769.1.12302 WP_003096769.1.12482 WP_003096769.1.12497 WP_003096769.1.12530 WP_003096769.1.12547 WP_003096769.1.12561 WP_003096769.1.12657 WP_003096769.1.12660 WP_003096769.1.12670 WP_003096769.1.12687 WP_003096769.1.12744 WP_003096769.1.12797 WP_003096769.1.12838 WP_003096769.1.12873 WP_003096769.1.12890 WP_003096769.1.12891 WP_003096769.1.12922 WP_003096769.1.12930 WP_003096769.1.12934 WP_003096769.1.12970 WP_003096769.1.12980 WP_003096769.1.13 WP_003096769.1.13041 WP_003096769.1.1305 WP_003096769.1.13057 WP_003096769.1.13077 WP_003096769.1.13085 WP_003096769.1.13092 WP_003096769.1.13208 WP_003096769.1.13232 WP_003096769.1.13242 WP_003096769.1.13266 WP_003096769.1.13270 WP_003096769.1.13315 WP_003096769.1.1333 WP_003096769.1.13364 WP_003096769.1.13407 WP_003096769.1.13529 WP_003096769.1.13533 WP_003096769.1.1356 WP_003096769.1.1362 WP_003096769.1.13622 WP_003096769.1.13642 WP_003096769.1.13718 WP_003096769.1.13743 WP_003096769.1.13758 WP_003096769.1.13765 WP_003096769.1.13785 WP_003096769.1.13795 WP_003096769.1.13828 WP_003096769.1.13865 WP_003096769.1.1393 WP_003096769.1.14049 WP_003096769.1.14078 WP_003096769.1.14096 WP_003096769.1.14116 WP_003096769.1.14204 WP_003096769.1.14251 WP_003096769.1.14345 WP_003096769.1.14378 WP_003096769.1.14424 WP_003096769.1.14455 WP_003096769.1.14460 WP_003096769.1.14463 WP_003096769.1.14476 WP_003096769.1.14525 WP_003096769.1.14564 WP_003096769.1.14615 WP_003096769.1.14640 WP_003096769.1.14679 WP_003096769.1.14690 WP_003096769.1.14714 WP_003096769.1.1475 WP_003096769.1.14754 WP_003096769.1.14797 WP_003096769.1.14815 WP_003096769.1.14820 WP_003096769.1.14835 WP_003096769.1.14839 WP_003096769.1.14883 WP_003096769.1.14981 WP_003096769.1.15130 WP_003096769.1.1516 WP_003096769.1.152 WP_003096769.1.15222 WP_003096769.1.15231 WP_003096769.1.15281 WP_003096769.1.15297 WP_003096769.1.15328 WP_003096769.1.15373 WP_003096769.1.15379 WP_003096769.1.15408 WP_003096769.1.15474 WP_003096769.1.15480 WP_003096769.1.15482 WP_003096769.1.15485 WP_003096769.1.15666 WP_003096769.1.15692 WP_003096769.1.15886 WP_003096769.1.15889 WP_003096769.1.16041 WP_003096769.1.16074 WP_003096769.1.16109 WP_003096769.1.16142 WP_003096769.1.16161 WP_003096769.1.16197 WP_003096769.1.162 WP_003096769.1.16239 WP_003096769.1.16267 WP_003096769.1.16279 WP_003096769.1.16419 WP_003096769.1.1646 WP_003096769.1.16660 WP_003096769.1.16694 WP_003096769.1.1670 WP_003096769.1.1671 WP_003096769.1.16751 WP_003096769.1.16782 WP_003096769.1.16808 WP_003096769.1.16811 WP_003096769.1.16895 WP_003096769.1.17022 WP_003096769.1.1704 WP_003096769.1.17108 WP_003096769.1.17155 WP_003096769.1.17177 WP_003096769.1.17189 WP_003096769.1.172 WP_003096769.1.17223 WP_003096769.1.17353 WP_003096769.1.17354 WP_003096769.1.17370 WP_003096769.1.1739 WP_003096769.1.17397 WP_003096769.1.17499 WP_003096769.1.17566 WP_003096769.1.1758 WP_003096769.1.1761 WP_003096769.1.17697 WP_003096769.1.17883 WP_003096769.1.17890 WP_003096769.1.18052 WP_003096769.1.18054 WP_003096769.1.18117 WP_003096769.1.18156 WP_003096769.1.18157 WP_003096769.1.18199 WP_003096769.1.18204 WP_003096769.1.18234 WP_003096769.1.1824 WP_003096769.1.18349 WP_003096769.1.18440 WP_003096769.1.18493 WP_003096769.1.18508 WP_003096769.1.18547 WP_003096769.1.18653 WP_003096769.1.18728 WP_003096769.1.18732 WP_003096769.1.18735 WP_003096769.1.18769 WP_003096769.1.18795 WP_003096769.1.18852 WP_003096769.1.18892 WP_003096769.1.18907 WP_003096769.1.18911 WP_003096769.1.18930 WP_003096769.1.190 WP_003096769.1.19089 WP_003096769.1.19199 WP_003096769.1.19251 WP_003096769.1.19260 WP_003096769.1.19269 WP_003096769.1.19346 WP_003096769.1.19351 WP_003096769.1.19376 WP_003096769.1.1938 WP_003096769.1.19552 WP_003096769.1.19591 WP_003096769.1.19640 WP_003096769.1.19703 WP_003096769.1.1971 WP_003096769.1.19718 WP_003096769.1.19741 WP_003096769.1.19771 WP_003096769.1.19803 WP_003096769.1.19824 WP_003096769.1.19930 WP_003096769.1.19931 WP_003096769.1.20024 WP_003096769.1.20070 WP_003096769.1.2012 WP_003096769.1.20125 WP_003096769.1.20134 WP_003096769.1.20216 WP_003096769.1.20342 WP_003096769.1.20590 WP_003096769.1.20607 WP_003096769.1.20682 WP_003096769.1.20692 WP_003096769.1.20744 WP_003096769.1.20764 WP_003096769.1.20825 WP_003096769.1.20854 WP_003096769.1.20880 WP_003096769.1.20884 WP_003096769.1.20890 WP_003096769.1.209 WP_003096769.1.20929 WP_003096769.1.20978 WP_003096769.1.21002 WP_003096769.1.21039 WP_003096769.1.21096 WP_003096769.1.21100 WP_003096769.1.21166 WP_003096769.1.21209 WP_003096769.1.21242 WP_003096769.1.21253 WP_003096769.1.21302 WP_003096769.1.21349 WP_003096769.1.21358 WP_003096769.1.2144 WP_003096769.1.21448 WP_003096769.1.21460 WP_003096769.1.21469 WP_003096769.1.21471 WP_003096769.1.21517 WP_003096769.1.21607 WP_003096769.1.21718 WP_003096769.1.2172 WP_003096769.1.21744 WP_003096769.1.21767 WP_003096769.1.21782 WP_003096769.1.21801 WP_003096769.1.21863 WP_003096769.1.21871 WP_003096769.1.21891 WP_003096769.1.21932 WP_003096769.1.22078 WP_003096769.1.221 WP_003096769.1.2228 WP_003096769.1.22324 WP_003096769.1.22365 WP_003096769.1.2237 WP_003096769.1.22390 WP_003096769.1.22394 WP_003096769.1.22442 WP_003096769.1.22477 WP_003096769.1.22491 WP_003096769.1.22573 WP_003096769.1.22671 WP_003096769.1.22704 WP_003096769.1.22729 WP_003096769.1.22863 WP_003096769.1.2289 WP_003096769.1.22891 WP_003096769.1.23013 WP_003096769.1.23166 WP_003096769.1.23191 WP_003096769.1.23195 WP_003096769.1.2323 WP_003096769.1.23264 WP_003096769.1.23331 WP_003096769.1.23394 WP_003096769.1.23418 WP_003096769.1.23421 WP_003096769.1.23518 WP_003096769.1.23523 WP_003096769.1.23525 WP_003096769.1.2355 WP_003096769.1.23559 WP_003096769.1.23581 WP_003096769.1.236 WP_003096769.1.23611 WP_003096769.1.23641 WP_003096769.1.23715 WP_003096769.1.23739 WP_003096769.1.2374 WP_003096769.1.23769 WP_003096769.1.23782 WP_003096769.1.23794 WP_003096769.1.23884 WP_003096769.1.23925 WP_003096769.1.23938 WP_003096769.1.23961 WP_003096769.1.23967 WP_003096769.1.23983 WP_003096769.1.24066 WP_003096769.1.24077 WP_003096769.1.24087 WP_003096769.1.24101 WP_003096769.1.24183 WP_003096769.1.24234 WP_003096769.1.24319 WP_003096769.1.24351 WP_003096769.1.24382 WP_003096769.1.24413 WP_003096769.1.24447 WP_003096769.1.2453 WP_003096769.1.24662 WP_003096769.1.2477 WP_003096769.1.24851 WP_003096769.1.24862 WP_003096769.1.24879 WP_003096769.1.24938 WP_003096769.1.24940 WP_003096769.1.25033 WP_003096769.1.25052 WP_003096769.1.25067 WP_003096769.1.25075 WP_003096769.1.251 WP_003096769.1.25109 WP_003096769.1.2511 WP_003096769.1.25142 WP_003096769.1.25149 WP_003096769.1.25179 WP_003096769.1.25191 WP_003096769.1.2529 WP_003096769.1.2530 WP_003096769.1.25328 WP_003096769.1.25344 WP_003096769.1.25348 WP_003096769.1.2535 WP_003096769.1.25477 WP_003096769.1.25532 WP_003096769.1.25600 WP_003096769.1.25641 WP_003096769.1.25695 WP_003096769.1.2572 WP_003096769.1.25834 WP_003096769.1.25903 WP_003096769.1.2596 WP_003096769.1.25964 WP_003096769.1.26010 WP_003096769.1.26025 WP_003096769.1.26042 WP_003096769.1.261 WP_003096769.1.26159 WP_003096769.1.26301 WP_003096769.1.26334 WP_003096769.1.26428 WP_003096769.1.26473 WP_003096769.1.26489 WP_003096769.1.2652 WP_003096769.1.26539 WP_003096769.1.26553 WP_003096769.1.26592 WP_003096769.1.26604 WP_003096769.1.26681 WP_003096769.1.26705 WP_003096769.1.26740 WP_003096769.1.26816 WP_003096769.1.26841 WP_003096769.1.26862 WP_003096769.1.26906 WP_003096769.1.26967 WP_003096769.1.2698 WP_003096769.1.27018 WP_003096769.1.27028 WP_003096769.1.27073 WP_003096769.1.27107 WP_003096769.1.27218 WP_003096769.1.27259 WP_003096769.1.27288 WP_003096769.1.27505 WP_003096769.1.27534 WP_003096769.1.27549 WP_003096769.1.27575 WP_003096769.1.27587 WP_003096769.1.27687 WP_003096769.1.27738 WP_003096769.1.27783 WP_003096769.1.27825 WP_003096769.1.27837 WP_003096769.1.27858 WP_003096769.1.27933 WP_003096769.1.27939 WP_003096769.1.27966 WP_003096769.1.28006 WP_003096769.1.28057 WP_003096769.1.28064 WP_003096769.1.28078 WP_003096769.1.28136 WP_003096769.1.28175 WP_003096769.1.28193 WP_003096769.1.28258 WP_003096769.1.283 WP_003096769.1.28316 WP_003096769.1.28329 WP_003096769.1.28382 WP_003096769.1.28383 WP_003096769.1.28404 WP_003096769.1.28468 WP_003096769.1.28528 WP_003096769.1.28602 WP_003096769.1.28623 WP_003096769.1.28699 WP_003096769.1.28713 WP_003096769.1.28757 WP_003096769.1.28800 WP_003096769.1.28823 WP_003096769.1.28838 WP_003096769.1.28849 WP_003096769.1.28878 WP_003096769.1.29008 WP_003096769.1.29062 WP_003096769.1.29070 WP_003096769.1.29096 WP_003096769.1.29127 WP_003096769.1.29137 WP_003096769.1.29158 WP_003096769.1.29179 WP_003096769.1.29208 WP_003096769.1.2927 WP_003096769.1.29401 WP_003096769.1.2941 WP_003096769.1.29438 WP_003096769.1.29440 WP_003096769.1.29472 WP_003096769.1.2948 WP_003096769.1.29481 WP_003096769.1.29498 WP_003096769.1.29501 WP_003096769.1.29577 WP_003096769.1.2961 WP_003096769.1.29633 WP_003096769.1.29650 WP_003096769.1.29668 WP_003096769.1.29753 WP_003096769.1.29767 WP_003096769.1.2980 WP_003096769.1.29848 WP_003096769.1.29920 WP_003096769.1.29958 WP_003096769.1.29973 WP_003096769.1.30000 WP_003096769.1.30020 WP_003096769.1.30081 WP_003096769.1.30120 WP_003096769.1.30254 WP_003096769.1.3030 WP_003096769.1.30474 WP_003096769.1.30475 WP_003096769.1.30563 WP_003096769.1.30567 WP_003096769.1.30614 WP_003096769.1.30615 WP_003096769.1.30625 WP_003096769.1.30693 WP_003096769.1.30707 WP_003096769.1.3072 WP_003096769.1.30740 WP_003096769.1.30797 WP_003096769.1.30810 WP_003096769.1.30815 WP_003096769.1.30842 WP_003096769.1.30886 WP_003096769.1.30943 WP_003096769.1.30973 WP_003096769.1.30994 WP_003096769.1.31045 WP_003096769.1.31076 WP_003096769.1.31087 WP_003096769.1.31103 WP_003096769.1.31105 WP_003096769.1.31138 WP_003096769.1.31147 WP_003096769.1.31279 WP_003096769.1.31361 WP_003096769.1.31457 WP_003096769.1.31501 WP_003096769.1.31563 WP_003096769.1.31565 WP_003096769.1.31587 WP_003096769.1.31633 WP_003096769.1.31655 WP_003096769.1.3172 WP_003096769.1.31732 WP_003096769.1.31741 WP_003096769.1.31751 WP_003096769.1.3179 WP_003096769.1.31848 WP_003096769.1.31852 WP_003096769.1.3189 WP_003096769.1.319 WP_003096769.1.31939 WP_003096769.1.32134 WP_003096769.1.32144 WP_003096769.1.32235 WP_003096769.1.32314 WP_003096769.1.32359 WP_003096769.1.32447 WP_003096769.1.32523 WP_003096769.1.32544 WP_003096769.1.32596 WP_003096769.1.32626 WP_003096769.1.32641 WP_003096769.1.32711 WP_003096769.1.32821 WP_003096769.1.32869 WP_003096769.1.32879 WP_003096769.1.32998 WP_003096769.1.33009 WP_003096769.1.33047 WP_003096769.1.33097 WP_003096769.1.33133 WP_003096769.1.33152 WP_003096769.1.33186 WP_003096769.1.33204 WP_003096769.1.33210 WP_003096769.1.33216 WP_003096769.1.33294 WP_003096769.1.33340 WP_003096769.1.33387 WP_003096769.1.33438 WP_003096769.1.33441 WP_003096769.1.33455 WP_003096769.1.3351 WP_003096769.1.33517 WP_003096769.1.33521 WP_003096769.1.33523 WP_003096769.1.33547 WP_003096769.1.33653 WP_003096769.1.33658 WP_003096769.1.33669 WP_003096769.1.3368 WP_003096769.1.33728 WP_003096769.1.33733 WP_003096769.1.3376 WP_003096769.1.33774 WP_003096769.1.33801 WP_003096769.1.33814 WP_003096769.1.33822 WP_003096769.1.33824 WP_003096769.1.33833 WP_003096769.1.3385 WP_003096769.1.33945 WP_003096769.1.34000 WP_003096769.1.34039 WP_003096769.1.34136 WP_003096769.1.34150 WP_003096769.1.34151 WP_003096769.1.34180 WP_003096769.1.34191 WP_003096769.1.34203 WP_003096769.1.34306 WP_003096769.1.34317 WP_003096769.1.34324 WP_003096769.1.3436 WP_003096769.1.34401 WP_003096769.1.34402 WP_003096769.1.34461 WP_003096769.1.34465 WP_003096769.1.34472 WP_003096769.1.3452 WP_003096769.1.34556 WP_003096769.1.34568 WP_003096769.1.34583 WP_003096769.1.34625 WP_003096769.1.34731 WP_003096769.1.34784 WP_003096769.1.34821 WP_003096769.1.34832 WP_003096769.1.34836 WP_003096769.1.34837 WP_003096769.1.34876 WP_003096769.1.34878 WP_003096769.1.34922 WP_003096769.1.34942 WP_003096769.1.35036 WP_003096769.1.35104 WP_003096769.1.35149 WP_003096769.1.35231 WP_003096769.1.35281 WP_003096769.1.3531 WP_003096769.1.35325 WP_003096769.1.35353 WP_003096769.1.3540 WP_003096769.1.35431 WP_003096769.1.35442 WP_003096769.1.35480 WP_003096769.1.35512 WP_003096769.1.35529 WP_003096769.1.3555 WP_003096769.1.35573 WP_003096769.1.35599 WP_003096769.1.35639 WP_003096769.1.35641 WP_003096769.1.35669 WP_003096769.1.35679 WP_003096769.1.3568 WP_003096769.1.35682 WP_003096769.1.3576 WP_003096769.1.35762 WP_003096769.1.35768 WP_003096769.1.35822 WP_003096769.1.35843 WP_003096769.1.35857 WP_003096769.1.35872 WP_003096769.1.35968 WP_003096769.1.35984 WP_003096769.1.36064 WP_003096769.1.36121 WP_003096769.1.36148 WP_003096769.1.36170 WP_003096769.1.36266 WP_003096769.1.36267 WP_003096769.1.36285 WP_003096769.1.36329 WP_003096769.1.36378 WP_003096769.1.36435 WP_003096769.1.36487 WP_003096769.1.36521 WP_003096769.1.3653 WP_003096769.1.36587 WP_003096769.1.36608 WP_003096769.1.3662 WP_003096769.1.36630 WP_003096769.1.36665 WP_003096769.1.36708 WP_003096769.1.3672 WP_003096769.1.36756 WP_003096769.1.36781 WP_003096769.1.36879 WP_003096769.1.37050 WP_003096769.1.37097 WP_003096769.1.37125 WP_003096769.1.37163 WP_003096769.1.37172 WP_003096769.1.37208 WP_003096769.1.3721 WP_003096769.1.37216 WP_003096769.1.373 WP_003096769.1.37319 WP_003096769.1.37416 WP_003096769.1.3742 WP_003096769.1.37500 WP_003096769.1.37512 WP_003096769.1.37571 WP_003096769.1.3768 WP_003096769.1.37698 WP_003096769.1.37703 WP_003096769.1.3773 WP_003096769.1.37799 WP_003096769.1.3781 WP_003096769.1.37814 WP_003096769.1.37818 WP_003096769.1.37826 WP_003096769.1.37842 WP_003096769.1.3785 WP_003096769.1.3792 WP_003096769.1.38003 WP_003096769.1.38023 WP_003096769.1.38060 WP_003096769.1.38087 WP_003096769.1.38102 WP_003096769.1.38146 WP_003096769.1.38151 WP_003096769.1.3818 WP_003096769.1.38186 WP_003096769.1.3821 WP_003096769.1.38319 WP_003096769.1.3833 WP_003096769.1.38335 WP_003096769.1.38337 WP_003096769.1.38406 WP_003096769.1.38450 WP_003096769.1.38502 WP_003096769.1.38505 WP_003096769.1.38582 WP_003096769.1.38583 WP_003096769.1.38587 WP_003096769.1.38657 WP_003096769.1.38661 WP_003096769.1.3870 WP_003096769.1.38706 WP_003096769.1.38727 WP_003096769.1.38816 WP_003096769.1.38834 WP_003096769.1.38889 WP_003096769.1.38932 WP_003096769.1.38971 WP_003096769.1.39046 WP_003096769.1.39088 WP_003096769.1.39122 WP_003096769.1.39186 WP_003096769.1.39271 WP_003096769.1.39326 WP_003096769.1.39345 WP_003096769.1.3943 WP_003096769.1.39444 WP_003096769.1.39452 WP_003096769.1.39458 WP_003096769.1.39765 WP_003096769.1.39786 WP_003096769.1.39811 WP_003096769.1.39920 WP_003096769.1.39949 WP_003096769.1.3998 WP_003096769.1.39989 WP_003096769.1.40115 WP_003096769.1.40135 WP_003096769.1.40207 WP_003096769.1.40213 WP_003096769.1.40237 WP_003096769.1.40243 WP_003096769.1.40271 WP_003096769.1.4038 WP_003096769.1.40419 WP_003096769.1.40442 WP_003096769.1.40512 WP_003096769.1.40513 WP_003096769.1.40541 WP_003096769.1.40546 WP_003096769.1.4058 WP_003096769.1.40595 WP_003096769.1.40703 WP_003096769.1.40874 WP_003096769.1.40950 WP_003096769.1.40984 WP_003096769.1.40994 WP_003096769.1.41110 WP_003096769.1.41137 WP_003096769.1.41199 WP_003096769.1.41290 WP_003096769.1.41291 WP_003096769.1.41301 WP_003096769.1.41384 WP_003096769.1.41429 WP_003096769.1.41487 WP_003096769.1.41492 WP_003096769.1.41502 WP_003096769.1.4156 WP_003096769.1.41618 WP_003096769.1.41624 WP_003096769.1.41625 WP_003096769.1.41692 WP_003096769.1.41703 WP_003096769.1.41725 WP_003096769.1.41732 WP_003096769.1.41748 WP_003096769.1.41773 WP_003096769.1.41832 WP_003096769.1.41846 WP_003096769.1.41871 WP_003096769.1.41888 WP_003096769.1.4190 WP_003096769.1.41939 WP_003096769.1.4196 WP_003096769.1.42 WP_003096769.1.42019 WP_003096769.1.42041 WP_003096769.1.42047 WP_003096769.1.42146 WP_003096769.1.42294 WP_003096769.1.42316 WP_003096769.1.42381 WP_003096769.1.42388 WP_003096769.1.42411 WP_003096769.1.42463 WP_003096769.1.42499 WP_003096769.1.42508 WP_003096769.1.42634 WP_003096769.1.42643 WP_003096769.1.42690 WP_003096769.1.42696 WP_003096769.1.42723 WP_003096769.1.4273 WP_003096769.1.42754 WP_003096769.1.42757 WP_003096769.1.42778 WP_003096769.1.42789 WP_003096769.1.42854 WP_003096769.1.42856 WP_003096769.1.42870 WP_003096769.1.42917 WP_003096769.1.42952 WP_003096769.1.42972 WP_003096769.1.42973 WP_003096769.1.43022 WP_003096769.1.43024 WP_003096769.1.43026 WP_003096769.1.43049 WP_003096769.1.43107 WP_003096769.1.43212 WP_003096769.1.43245 WP_003096769.1.43286 WP_003096769.1.43293 WP_003096769.1.43315 WP_003096769.1.43326 WP_003096769.1.43356 WP_003096769.1.4348 WP_003096769.1.43593 WP_003096769.1.43603 WP_003096769.1.43662 WP_003096769.1.43667 WP_003096769.1.43673 WP_003096769.1.43696 WP_003096769.1.43729 WP_003096769.1.43756 WP_003096769.1.43783 WP_003096769.1.43802 WP_003096769.1.4381 WP_003096769.1.43811 WP_003096769.1.43826 WP_003096769.1.4397 WP_003096769.1.4398 WP_003096769.1.43998 WP_003096769.1.44046 WP_003096769.1.44094 WP_003096769.1.44213 WP_003096769.1.44260 WP_003096769.1.44269 WP_003096769.1.44434 WP_003096769.1.44486 WP_003096769.1.445 WP_003096769.1.44552 WP_003096769.1.44563 WP_003096769.1.44581 WP_003096769.1.44725 WP_003096769.1.44739 WP_003096769.1.44760 WP_003096769.1.44804 WP_003096769.1.44870 WP_003096769.1.44959 WP_003096769.1.45063 WP_003096769.1.45090 WP_003096769.1.45146 WP_003096769.1.45199 WP_003096769.1.45202 WP_003096769.1.4522 WP_003096769.1.45228 WP_003096769.1.45306 WP_003096769.1.45312 WP_003096769.1.45328 WP_003096769.1.45353 WP_003096769.1.45358 WP_003096769.1.45464 WP_003096769.1.45478 WP_003096769.1.45485 WP_003096769.1.45604 WP_003096769.1.45611 WP_003096769.1.45635 WP_003096769.1.45636 WP_003096769.1.45678 WP_003096769.1.45700 WP_003096769.1.45711 WP_003096769.1.45723 WP_003096769.1.45818 WP_003096769.1.45837 WP_003096769.1.45920 WP_003096769.1.45934 WP_003096769.1.45946 WP_003096769.1.45961 WP_003096769.1.46032 WP_003096769.1.46093 WP_003096769.1.461 WP_003096769.1.46152 WP_003096769.1.46200 WP_003096769.1.46306 WP_003096769.1.4640 WP_003096769.1.46436 WP_003096769.1.46502 WP_003096769.1.46623 WP_003096769.1.46633 WP_003096769.1.46755 WP_003096769.1.46787 WP_003096769.1.46826 WP_003096769.1.46846 WP_003096769.1.46866 WP_003096769.1.46885 WP_003096769.1.46926 WP_003096769.1.46935 WP_003096769.1.47101 WP_003096769.1.47150 WP_003096769.1.47155 WP_003096769.1.47158 WP_003096769.1.47251 WP_003096769.1.4726 WP_003096769.1.47296 WP_003096769.1.47312 WP_003096769.1.47374 WP_003096769.1.47469 WP_003096769.1.47480 WP_003096769.1.47527 WP_003096769.1.47551 WP_003096769.1.47598 WP_003096769.1.47645 WP_003096769.1.47774 WP_003096769.1.47930 WP_003096769.1.47934 WP_003096769.1.47970 WP_003096769.1.48001 WP_003096769.1.48086 WP_003096769.1.48141 WP_003096769.1.48172 WP_003096769.1.48178 WP_003096769.1.48321 WP_003096769.1.48334 WP_003096769.1.4836 WP_003096769.1.48378 WP_003096769.1.48382 WP_003096769.1.48413 WP_003096769.1.48472 WP_003096769.1.48474 WP_003096769.1.48487 WP_003096769.1.48545 WP_003096769.1.48579 WP_003096769.1.48747 WP_003096769.1.48810 WP_003096769.1.48820 WP_003096769.1.48840 WP_003096769.1.48842 WP_003096769.1.48851 WP_003096769.1.48870 WP_003096769.1.48961 WP_003096769.1.48990 WP_003096769.1.49108 WP_003096769.1.4913 WP_003096769.1.49135 WP_003096769.1.49244 WP_003096769.1.49265 WP_003096769.1.49266 WP_003096769.1.49277 WP_003096769.1.49286 WP_003096769.1.49293 WP_003096769.1.49360 WP_003096769.1.49416 WP_003096769.1.49500 WP_003096769.1.49557 WP_003096769.1.49566 WP_003096769.1.49688 WP_003096769.1.49798 WP_003096769.1.49806 WP_003096769.1.49833 WP_003096769.1.49842 WP_003096769.1.49922 WP_003096769.1.49948 WP_003096769.1.49976 WP_003096769.1.49988 WP_003096769.1.49998 WP_003096769.1.50176 WP_003096769.1.50180 WP_003096769.1.50242 WP_003096769.1.5043 WP_003096769.1.50450 WP_003096769.1.50459 WP_003096769.1.50567 WP_003096769.1.50653 WP_003096769.1.50665 WP_003096769.1.50668 WP_003096769.1.50682 WP_003096769.1.50691 WP_003096769.1.50734 WP_003096769.1.50783 WP_003096769.1.50922 WP_003096769.1.50967 WP_003096769.1.50989 WP_003096769.1.51019 WP_003096769.1.51136 WP_003096769.1.51141 WP_003096769.1.51173 WP_003096769.1.51185 WP_003096769.1.51457 WP_003096769.1.51472 WP_003096769.1.51501 WP_003096769.1.51538 WP_003096769.1.51549 WP_003096769.1.51585 WP_003096769.1.51682 WP_003096769.1.51727 WP_003096769.1.51733 WP_003096769.1.51807 WP_003096769.1.51847 WP_003096769.1.51889 WP_003096769.1.51917 WP_003096769.1.51928 WP_003096769.1.51937 WP_003096769.1.51943 WP_003096769.1.51957 WP_003096769.1.51976 WP_003096769.1.52146 WP_003096769.1.52152 WP_003096769.1.52212 WP_003096769.1.52220 WP_003096769.1.52244 WP_003096769.1.5226 WP_003096769.1.52326 WP_003096769.1.52334 WP_003096769.1.5235 WP_003096769.1.52355 WP_003096769.1.52372 WP_003096769.1.52403 WP_003096769.1.52409 WP_003096769.1.52449 WP_003096769.1.52500 WP_003096769.1.52537 WP_003096769.1.5258 WP_003096769.1.52583 WP_003096769.1.52591 WP_003096769.1.5260 WP_003096769.1.52690 WP_003096769.1.52697 WP_003096769.1.52700 WP_003096769.1.52728 WP_003096769.1.52784 WP_003096769.1.52790 WP_003096769.1.52810 WP_003096769.1.52850 WP_003096769.1.52868 WP_003096769.1.5289 WP_003096769.1.52939 WP_003096769.1.5294 WP_003096769.1.53037 WP_003096769.1.53038 WP_003096769.1.53070 WP_003096769.1.53072 WP_003096769.1.53267 WP_003096769.1.53287 WP_003096769.1.53351 WP_003096769.1.53371 WP_003096769.1.53414 WP_003096769.1.53427 WP_003096769.1.53486 WP_003096769.1.53528 WP_003096769.1.53530 WP_003096769.1.53586 WP_003096769.1.53663 WP_003096769.1.53678 WP_003096769.1.53719 WP_003096769.1.53726 WP_003096769.1.53826 WP_003096769.1.5388 WP_003096769.1.53932 WP_003096769.1.53946 WP_003096769.1.53948 WP_003096769.1.53951 WP_003096769.1.5399 WP_003096769.1.54003 WP_003096769.1.54076 WP_003096769.1.54078 WP_003096769.1.54090 WP_003096769.1.54133 WP_003096769.1.54140 WP_003096769.1.54146 WP_003096769.1.5420 WP_003096769.1.54248 WP_003096769.1.5427 WP_003096769.1.54293 WP_003096769.1.54354 WP_003096769.1.54362 WP_003096769.1.54462 WP_003096769.1.54497 WP_003096769.1.54571 WP_003096769.1.54742 WP_003096769.1.54809 WP_003096769.1.54974 WP_003096769.1.55 WP_003096769.1.55089 WP_003096769.1.55169 WP_003096769.1.55245 WP_003096769.1.55318 WP_003096769.1.55347 WP_003096769.1.55387 WP_003096769.1.55400 WP_003096769.1.55445 WP_003096769.1.55478 WP_003096769.1.55729 WP_003096769.1.55765 WP_003096769.1.55813 WP_003096769.1.55976 WP_003096769.1.56013 WP_003096769.1.56037 WP_003096769.1.56145 WP_003096769.1.56171 WP_003096769.1.56187 WP_003096769.1.56188 WP_003096769.1.56196 WP_003096769.1.56228 WP_003096769.1.56229 WP_003096769.1.56315 WP_003096769.1.56348 WP_003096769.1.56442 WP_003096769.1.56452 WP_003096769.1.56465 WP_003096769.1.56474 WP_003096769.1.56475 WP_003096769.1.56623 WP_003096769.1.56626 WP_003096769.1.56632 WP_003096769.1.56745 WP_003096769.1.56768 WP_003096769.1.56797 WP_003096769.1.56808 WP_003096769.1.56819 WP_003096769.1.56837 WP_003096769.1.56850 WP_003096769.1.56864 WP_003096769.1.56896 WP_003096769.1.56943 WP_003096769.1.56973 WP_003096769.1.57005 WP_003096769.1.57020 WP_003096769.1.57065 WP_003096769.1.57113 WP_003096769.1.57131 WP_003096769.1.57140 WP_003096769.1.57276 WP_003096769.1.5731 WP_003096769.1.57339 WP_003096769.1.57369 WP_003096769.1.57417 WP_003096769.1.57460 WP_003096769.1.57477 WP_003096769.1.57480 WP_003096769.1.57532 WP_003096769.1.57548 WP_003096769.1.57566 WP_003096769.1.57728 WP_003096769.1.57792 WP_003096769.1.57839 WP_003096769.1.57853 WP_003096769.1.57921 WP_003096769.1.58019 WP_003096769.1.58056 WP_003096769.1.58155 WP_003096769.1.58162 WP_003096769.1.58183 WP_003096769.1.58193 WP_003096769.1.58200 WP_003096769.1.58228 WP_003096769.1.58294 WP_003096769.1.58360 WP_003096769.1.58436 WP_003096769.1.58482 WP_003096769.1.58510 WP_003096769.1.5856 WP_003096769.1.58581 WP_003096769.1.58689 WP_003096769.1.5869 WP_003096769.1.58785 WP_003096769.1.58800 WP_003096769.1.5889 WP_003096769.1.58944 WP_003096769.1.58952 WP_003096769.1.5897 WP_003096769.1.59013 WP_003096769.1.59076 WP_003096769.1.59099 WP_003096769.1.59123 WP_003096769.1.59156 WP_003096769.1.59158 WP_003096769.1.59176 WP_003096769.1.59212 WP_003096769.1.59246 WP_003096769.1.59249 WP_003096769.1.59288 WP_003096769.1.59339 WP_003096769.1.5937 WP_003096769.1.59376 WP_003096769.1.59385 WP_003096769.1.594 WP_003096769.1.59469 WP_003096769.1.59563 WP_003096769.1.59688 WP_003096769.1.59724 WP_003096769.1.59797 WP_003096769.1.59831 WP_003096769.1.59870 WP_003096769.1.59943 WP_003096769.1.60051 WP_003096769.1.60079 WP_003096769.1.60082 WP_003096769.1.60084 WP_003096769.1.60085 WP_003096769.1.60206 WP_003096769.1.60261 WP_003096769.1.60347 WP_003096769.1.60364 WP_003096769.1.60415 WP_003096769.1.60467 WP_003096769.1.60472 WP_003096769.1.60509 WP_003096769.1.60600 WP_003096769.1.60602 WP_003096769.1.60603 WP_003096769.1.60639 WP_003096769.1.60679 WP_003096769.1.60686 WP_003096769.1.607 WP_003096769.1.60910 WP_003096769.1.60916 WP_003096769.1.60970 WP_003096769.1.60979 WP_003096769.1.61130 WP_003096769.1.61191 WP_003096769.1.61209 WP_003096769.1.61222 WP_003096769.1.61269 WP_003096769.1.61288 WP_003096769.1.61299 WP_003096769.1.6130 WP_003096769.1.61366 WP_003096769.1.61431 WP_003096769.1.61493 WP_003096769.1.61549 WP_003096769.1.61589 WP_003096769.1.61598 WP_003096769.1.616 WP_003096769.1.61696 WP_003096769.1.61943 WP_003096769.1.62010 WP_003096769.1.62035 WP_003096769.1.62180 WP_003096769.1.62186 WP_003096769.1.62211 WP_003096769.1.62263 WP_003096769.1.62357 WP_003096769.1.62396 WP_003096769.1.62410 WP_003096769.1.6242 WP_003096769.1.62483 WP_003096769.1.6249 WP_003096769.1.62516 WP_003096769.1.62534 WP_003096769.1.626 WP_003096769.1.62604 WP_003096769.1.62635 WP_003096769.1.62701 WP_003096769.1.62703 WP_003096769.1.62704 WP_003096769.1.62708 WP_003096769.1.62768 WP_003096769.1.62772 WP_003096769.1.6280 WP_003096769.1.6283 WP_003096769.1.62834 WP_003096769.1.62838 WP_003096769.1.62873 WP_003096769.1.62917 WP_003096769.1.62961 WP_003096769.1.62977 WP_003096769.1.63038 WP_003096769.1.63041 WP_003096769.1.63057 WP_003096769.1.63124 WP_003096769.1.63193 WP_003096769.1.63196 WP_003096769.1.63369 WP_003096769.1.63401 WP_003096769.1.63591 WP_003096769.1.63597 WP_003096769.1.63634 WP_003096769.1.63659 WP_003096769.1.63739 WP_003096769.1.63784 WP_003096769.1.63929 WP_003096769.1.63941 WP_003096769.1.63989 WP_003096769.1.63995 WP_003096769.1.64139 WP_003096769.1.64155 WP_003096769.1.64198 WP_003096769.1.64212 WP_003096769.1.64309 WP_003096769.1.64329 WP_003096769.1.64340 WP_003096769.1.64433 WP_003096769.1.6450 WP_003096769.1.64544 WP_003096769.1.64591 WP_003096769.1.64603 WP_003096769.1.64605 WP_003096769.1.6461 WP_003096769.1.64611 WP_003096769.1.64726 WP_003096769.1.64748 WP_003096769.1.64799 WP_003096769.1.64807 WP_003096769.1.64854 WP_003096769.1.64862 WP_003096769.1.64880 WP_003096769.1.64885 WP_003096769.1.64886 WP_003096769.1.64983 WP_003096769.1.64984 WP_003096769.1.65066 WP_003096769.1.65092 WP_003096769.1.65095 WP_003096769.1.65099 WP_003096769.1.65145 WP_003096769.1.65196 WP_003096769.1.65197 WP_003096769.1.65227 WP_003096769.1.65247 WP_003096769.1.65285 WP_003096769.1.65304 WP_003096769.1.65312 WP_003096769.1.65334 WP_003096769.1.65335 WP_003096769.1.65457 WP_003096769.1.65478 WP_003096769.1.65549 WP_003096769.1.65588 WP_003096769.1.65632 WP_003096769.1.65642 WP_003096769.1.65679 WP_003096769.1.65740 WP_003096769.1.65819 WP_003096769.1.65867 WP_003096769.1.6589 WP_003096769.1.65926 WP_003096769.1.66062 WP_003096769.1.66088 WP_003096769.1.66155 WP_003096769.1.66165 WP_003096769.1.6627 WP_003096769.1.66277 WP_003096769.1.66345 WP_003096769.1.66348 WP_003096769.1.66364 WP_003096769.1.66410 WP_003096769.1.66526 WP_003096769.1.66563 WP_003096769.1.66584 WP_003096769.1.66634 WP_003096769.1.66693 WP_003096769.1.66892 WP_003096769.1.66929 WP_003096769.1.66931 WP_003096769.1.66945 WP_003096769.1.66950 WP_003096769.1.66982 WP_003096769.1.67010 WP_003096769.1.67124 WP_003096769.1.67188 WP_003096769.1.67192 WP_003096769.1.67205 WP_003096769.1.67261 WP_003096769.1.67269 WP_003096769.1.6734 WP_003096769.1.67370 WP_003096769.1.67388 WP_003096769.1.67472 WP_003096769.1.67489 WP_003096769.1.67506 WP_003096769.1.67526 WP_003096769.1.67531 WP_003096769.1.67545 WP_003096769.1.6768 WP_003096769.1.67686 WP_003096769.1.67755 WP_003096769.1.67830 WP_003096769.1.67874 WP_003096769.1.67875 WP_003096769.1.67899 WP_003096769.1.67903 WP_003096769.1.67937 WP_003096769.1.67948 WP_003096769.1.6796 WP_003096769.1.68000 WP_003096769.1.6808 WP_003096769.1.68158 WP_003096769.1.68172 WP_003096769.1.68183 WP_003096769.1.68194 WP_003096769.1.68252 WP_003096769.1.68317 WP_003096769.1.68446 WP_003096769.1.68448 WP_003096769.1.68472 WP_003096769.1.68499 WP_003096769.1.6850 WP_003096769.1.68561 WP_003096769.1.68568 WP_003096769.1.68638 WP_003096769.1.6866 WP_003096769.1.68756 WP_003096769.1.68781 WP_003096769.1.68790 WP_003096769.1.68800 WP_003096769.1.68802 WP_003096769.1.68850 WP_003096769.1.68857 WP_003096769.1.68862 WP_003096769.1.68881 WP_003096769.1.68910 WP_003096769.1.68938 WP_003096769.1.68979 WP_003096769.1.69088 WP_003096769.1.6911 WP_003096769.1.69159 WP_003096769.1.69209 WP_003096769.1.69260 WP_003096769.1.6931 WP_003096769.1.69330 WP_003096769.1.6937 WP_003096769.1.69411 WP_003096769.1.69534 WP_003096769.1.69556 WP_003096769.1.69599 WP_003096769.1.69702 WP_003096769.1.69788 WP_003096769.1.69791 WP_003096769.1.69819 WP_003096769.1.69834 WP_003096769.1.69907 WP_003096769.1.69993 WP_003096769.1.70092 WP_003096769.1.70098 WP_003096769.1.70138 WP_003096769.1.70168 WP_003096769.1.70194 WP_003096769.1.70216 WP_003096769.1.70229 WP_003096769.1.70331 WP_003096769.1.70470 WP_003096769.1.70537 WP_003096769.1.70561 WP_003096769.1.70583 WP_003096769.1.70648 WP_003096769.1.70650 WP_003096769.1.70670 WP_003096769.1.70693 WP_003096769.1.70778 WP_003096769.1.70831 WP_003096769.1.70991 WP_003096769.1.71038 WP_003096769.1.71141 WP_003096769.1.71203 WP_003096769.1.71234 WP_003096769.1.71249 WP_003096769.1.71254 WP_003096769.1.7128 WP_003096769.1.71290 WP_003096769.1.71346 WP_003096769.1.71385 WP_003096769.1.71412 WP_003096769.1.71570 WP_003096769.1.71610 WP_003096769.1.7163 WP_003096769.1.71642 WP_003096769.1.71666 WP_003096769.1.71799 WP_003096769.1.71806 WP_003096769.1.71822 WP_003096769.1.71862 WP_003096769.1.71866 WP_003096769.1.71891 WP_003096769.1.71927 WP_003096769.1.71934 WP_003096769.1.72149 WP_003096769.1.72167 WP_003096769.1.72181 WP_003096769.1.72183 WP_003096769.1.7219 WP_003096769.1.72287 WP_003096769.1.72323 WP_003096769.1.72331 WP_003096769.1.72346 WP_003096769.1.72378 WP_003096769.1.72447 WP_003096769.1.72458 WP_003096769.1.72477 WP_003096769.1.72541 WP_003096769.1.72562 WP_003096769.1.72570 WP_003096769.1.72653 WP_003096769.1.72662 WP_003096769.1.72669 WP_003096769.1.72727 WP_003096769.1.7276 WP_003096769.1.72768 WP_003096769.1.72772 WP_003096769.1.72782 WP_003096769.1.72845 WP_003096769.1.72920 WP_003096769.1.73035 WP_003096769.1.73048 WP_003096769.1.73135 WP_003096769.1.73149 WP_003096769.1.73172 WP_003096769.1.73192 WP_003096769.1.7327 WP_003096769.1.7329 WP_003096769.1.733 WP_003096769.1.73455 WP_003096769.1.73523 WP_003096769.1.73541 WP_003096769.1.73601 WP_003096769.1.73609 WP_003096769.1.73651 WP_003096769.1.73719 WP_003096769.1.73728 WP_003096769.1.7377 WP_003096769.1.7382 WP_003096769.1.73860 WP_003096769.1.73889 WP_003096769.1.73911 WP_003096769.1.73941 WP_003096769.1.74 WP_003096769.1.74000 WP_003096769.1.74072 WP_003096769.1.74074 WP_003096769.1.7408 WP_003096769.1.74106 WP_003096769.1.74167 WP_003096769.1.74175 WP_003096769.1.74180 WP_003096769.1.74219 WP_003096769.1.74264 WP_003096769.1.74268 WP_003096769.1.74281 WP_003096769.1.74287 WP_003096769.1.74326 WP_003096769.1.74458 WP_003096769.1.74473 WP_003096769.1.74475 WP_003096769.1.74518 WP_003096769.1.7456 WP_003096769.1.74568 WP_003096769.1.74604 WP_003096769.1.74629 WP_003096769.1.74685 WP_003096769.1.74772 WP_003096769.1.74776 WP_003096769.1.748 WP_003096769.1.74878 WP_003096769.1.74941 WP_003096769.1.74948 WP_003096769.1.7501 WP_003096769.1.75041 WP_003096769.1.75204 WP_003096769.1.75277 WP_003096769.1.75303 WP_003096769.1.75389 WP_003096769.1.75431 WP_003096769.1.7547 WP_003096769.1.75549 WP_003096769.1.75573 WP_003096769.1.75580 WP_003096769.1.75599 WP_003096769.1.75603 WP_003096769.1.75631 WP_003096769.1.7568 WP_003096769.1.75756 WP_003096769.1.75771 WP_003096769.1.75792 WP_003096769.1.75825 WP_003096769.1.75826 WP_003096769.1.75860 WP_003096769.1.75935 WP_003096769.1.75938 WP_003096769.1.75947 WP_003096769.1.7595 WP_003096769.1.76077 WP_003096769.1.76092 WP_003096769.1.76141 WP_003096769.1.76145 WP_003096769.1.76192 WP_003096769.1.76322 WP_003096769.1.76355 WP_003096769.1.76383 WP_003096769.1.76399 WP_003096769.1.76441 WP_003096769.1.76467 WP_003096769.1.76543 WP_003096769.1.76600 WP_003096769.1.76633 WP_003096769.1.7666 WP_003096769.1.76716 WP_003096769.1.76775 WP_003096769.1.76791 WP_003096769.1.76861 WP_003096769.1.76922 WP_003096769.1.76985 WP_003096769.1.77235 WP_003096769.1.77286 WP_003096769.1.77317 WP_003096769.1.77442 WP_003096769.1.77476 WP_003096769.1.77490 WP_003096769.1.77566 WP_003096769.1.77574 WP_003096769.1.77587 WP_003096769.1.77686 WP_003096769.1.77750 WP_003096769.1.7779 WP_003096769.1.77819 WP_003096769.1.77913 WP_003096769.1.78104 WP_003096769.1.78112 WP_003096769.1.78118 WP_003096769.1.78134 WP_003096769.1.78148 WP_003096769.1.78158 WP_003096769.1.78280 WP_003096769.1.78288 WP_003096769.1.78380 WP_003096769.1.7840 WP_003096769.1.78409 WP_003096769.1.78425 WP_003096769.1.78430 WP_003096769.1.78437 WP_003096769.1.78570 WP_003096769.1.78599 WP_003096769.1.78623 WP_003096769.1.78669 WP_003096769.1.78693 WP_003096769.1.78795 WP_003096769.1.788 WP_003096769.1.78810 WP_003096769.1.78926 WP_003096769.1.78947 WP_003096769.1.78954 WP_003096769.1.78986 WP_003096769.1.7899 WP_003096769.1.79003 WP_003096769.1.79053 WP_003096769.1.79060 WP_003096769.1.79177 WP_003096769.1.79193 WP_003096769.1.79256 WP_003096769.1.79279 WP_003096769.1.79286 WP_003096769.1.79311 WP_003096769.1.79357 WP_003096769.1.79364 WP_003096769.1.79421 WP_003096769.1.79431 WP_003096769.1.7945 WP_003096769.1.79463 WP_003096769.1.79507 WP_003096769.1.7953 WP_003096769.1.79544 WP_003096769.1.79569 WP_003096769.1.79601 WP_003096769.1.79631 WP_003096769.1.79699 WP_003096769.1.79754 WP_003096769.1.79788 WP_003096769.1.79862 WP_003096769.1.79883 WP_003096769.1.799 WP_003096769.1.79902 WP_003096769.1.79908 WP_003096769.1.79986 WP_003096769.1.8 WP_003096769.1.80033 WP_003096769.1.80068 WP_003096769.1.80102 WP_003096769.1.8013 WP_003096769.1.80174 WP_003096769.1.80258 WP_003096769.1.8028 WP_003096769.1.80306 WP_003096769.1.8038 WP_003096769.1.80410 WP_003096769.1.80411 WP_003096769.1.80454 WP_003096769.1.80481 WP_003096769.1.8051 WP_003096769.1.80535 WP_003096769.1.80572 WP_003096769.1.80627 WP_003096769.1.80632 WP_003096769.1.8064 WP_003096769.1.80644 WP_003096769.1.80645 WP_003096769.1.80683 WP_003096769.1.80715 WP_003096769.1.80720 WP_003096769.1.80785 WP_003096769.1.80846 WP_003096769.1.80880 WP_003096769.1.80892 WP_003096769.1.80910 WP_003096769.1.80926 WP_003096769.1.80929 WP_003096769.1.80931 WP_003096769.1.80938 WP_003096769.1.80969 WP_003096769.1.81082 WP_003096769.1.8110 WP_003096769.1.81206 WP_003096769.1.81237 WP_003096769.1.81331 WP_003096769.1.81338 WP_003096769.1.81349 WP_003096769.1.81380 WP_003096769.1.8141 WP_003096769.1.81426 WP_003096769.1.81470 WP_003096769.1.81482 WP_003096769.1.81487 WP_003096769.1.81581 WP_003096769.1.81591 WP_003096769.1.81622 WP_003096769.1.81643 WP_003096769.1.81708 WP_003096769.1.81742 WP_003096769.1.81748 WP_003096769.1.81771 WP_003096769.1.81784 WP_003096769.1.81802 WP_003096769.1.81834 WP_003096769.1.81844 WP_003096769.1.81856 WP_003096769.1.81874 WP_003096769.1.81927 WP_003096769.1.81950 WP_003096769.1.81957 WP_003096769.1.81960 WP_003096769.1.81986 WP_003096769.1.82117 WP_003096769.1.82178 WP_003096769.1.8227 WP_003096769.1.82310 WP_003096769.1.82312 WP_003096769.1.82328 WP_003096769.1.8238 WP_003096769.1.82442 WP_003096769.1.82487 WP_003096769.1.82580 WP_003096769.1.82604 WP_003096769.1.82606 WP_003096769.1.82620 WP_003096769.1.82643 WP_003096769.1.82686 WP_003096769.1.82710 WP_003096769.1.82798 WP_003096769.1.82810 WP_003096769.1.8284 WP_003096769.1.82864 WP_003096769.1.82882 WP_003096769.1.82887 WP_003096769.1.82936 WP_003096769.1.83025 WP_003096769.1.83131 WP_003096769.1.83184 WP_003096769.1.83213 WP_003096769.1.83251 WP_003096769.1.83267 WP_003096769.1.83296 WP_003096769.1.83317 WP_003096769.1.83374 WP_003096769.1.83394 WP_003096769.1.83440 WP_003096769.1.83460 WP_003096769.1.83463 WP_003096769.1.835 WP_003096769.1.83503 WP_003096769.1.8351 WP_003096769.1.8353 WP_003096769.1.83534 WP_003096769.1.83540 WP_003096769.1.8357 WP_003096769.1.83673 WP_003096769.1.83698 WP_003096769.1.83715 WP_003096769.1.83871 WP_003096769.1.83937 WP_003096769.1.83946 WP_003096769.1.84003 WP_003096769.1.84008 WP_003096769.1.84138 WP_003096769.1.84162 WP_003096769.1.84174 WP_003096769.1.84178 WP_003096769.1.84190 WP_003096769.1.84203 WP_003096769.1.84271 WP_003096769.1.84297 WP_003096769.1.8437 WP_003096769.1.84374 WP_003096769.1.84398 WP_003096769.1.84404 WP_003096769.1.84439 WP_003096769.1.84471 WP_003096769.1.84487 WP_003096769.1.84526 WP_003096769.1.8453 WP_003096769.1.84538 WP_003096769.1.84558 WP_003096769.1.84589 WP_003096769.1.84674 WP_003096769.1.84684 WP_003096769.1.84702 WP_003096769.1.84715 WP_003096769.1.84754 WP_003096769.1.84792 WP_003096769.1.84825 WP_003096769.1.8484 WP_003096769.1.84865 WP_003096769.1.84917 WP_003096769.1.84937 WP_003096769.1.84946 WP_003096769.1.8498 WP_003096769.1.85018 WP_003096769.1.85028 WP_003096769.1.85059 WP_003096769.1.85150 WP_003096769.1.85220 WP_003096769.1.85290 WP_003096769.1.85298 WP_003096769.1.85303 WP_003096769.1.85318 WP_003096769.1.85357 WP_003096769.1.85446 WP_003096769.1.85453 WP_003096769.1.85574 WP_003096769.1.85633 WP_003096769.1.85638 WP_003096769.1.85788 WP_003096769.1.85897 WP_003096769.1.85910 WP_003096769.1.85920 WP_003096769.1.85978 WP_003096769.1.86002 WP_003096769.1.86047 WP_003096769.1.86055 WP_003096769.1.86058 WP_003096769.1.861 WP_003096769.1.86125 WP_003096769.1.86182 WP_003096769.1.86243 WP_003096769.1.86278 WP_003096769.1.86287 WP_003096769.1.86293 WP_003096769.1.86386 WP_003096769.1.86432 WP_003096769.1.8645 WP_003096769.1.865 WP_003096769.1.86506 WP_003096769.1.86545 WP_003096769.1.86552 WP_003096769.1.86554 WP_003096769.1.86595 WP_003096769.1.86652 WP_003096769.1.86660 WP_003096769.1.86665 WP_003096769.1.867 WP_003096769.1.86708 WP_003096769.1.86733 WP_003096769.1.86774 WP_003096769.1.86780 WP_003096769.1.86796 WP_003096769.1.86822 WP_003096769.1.8693 WP_003096769.1.86947 WP_003096769.1.86970 WP_003096769.1.86985 WP_003096769.1.87104 WP_003096769.1.87163 WP_003096769.1.8718 WP_003096769.1.87182 WP_003096769.1.87183 WP_003096769.1.87316 WP_003096769.1.87390 WP_003096769.1.87435 WP_003096769.1.87463 WP_003096769.1.8749 WP_003096769.1.87530 WP_003096769.1.87547 WP_003096769.1.87648 WP_003096769.1.87763 WP_003096769.1.8777 WP_003096769.1.8785 WP_003096769.1.87888 WP_003096769.1.87970 WP_003096769.1.87975 WP_003096769.1.87981 WP_003096769.1.87987 WP_003096769.1.88004 WP_003096769.1.88308 WP_003096769.1.88360 WP_003096769.1.88388 WP_003096769.1.88415 WP_003096769.1.88517 WP_003096769.1.8852 WP_003096769.1.88540 WP_003096769.1.88550 WP_003096769.1.88578 WP_003096769.1.88605 WP_003096769.1.88659 WP_003096769.1.88679 WP_003096769.1.88680 WP_003096769.1.88714 WP_003096769.1.88750 WP_003096769.1.88796 WP_003096769.1.889 WP_003096769.1.88900 WP_003096769.1.88949 WP_003096769.1.88969 WP_003096769.1.89083 WP_003096769.1.8911 WP_003096769.1.89234 WP_003096769.1.89245 WP_003096769.1.89266 WP_003096769.1.89276 WP_003096769.1.89330 WP_003096769.1.89409 WP_003096769.1.89434 WP_003096769.1.89440 WP_003096769.1.89480 WP_003096769.1.8949 WP_003096769.1.89491 WP_003096769.1.89523 WP_003096769.1.89577 WP_003096769.1.89610 WP_003096769.1.89638 WP_003096769.1.89662 WP_003096769.1.89669 WP_003096769.1.89736 WP_003096769.1.89805 WP_003096769.1.89866 WP_003096769.1.89867 WP_003096769.1.89868 WP_003096769.1.89871 WP_003096769.1.89886 WP_003096769.1.89992 WP_003096769.1.90024 WP_003096769.1.90032 WP_003096769.1.90056 WP_003096769.1.90110 WP_003096769.1.90141 WP_003096769.1.90150 WP_003096769.1.90189 WP_003096769.1.90224 WP_003096769.1.90225 WP_003096769.1.90242 WP_003096769.1.90268 WP_003096769.1.90272 WP_003096769.1.90306 WP_003096769.1.90412 WP_003096769.1.9056 WP_003096769.1.90569 WP_003096769.1.90655 WP_003096769.1.90922 WP_003096769.1.90940 WP_003096769.1.90999 WP_003096769.1.91012 WP_003096769.1.91093 WP_003096769.1.91161 WP_003096769.1.9120 WP_003096769.1.91236 WP_003096769.1.91281 WP_003096769.1.91307 WP_003096769.1.91336 WP_003096769.1.91360 WP_003096769.1.91392 WP_003096769.1.91416 WP_003096769.1.9143 WP_003096769.1.91431 WP_003096769.1.91438 WP_003096769.1.91467 WP_003096769.1.91563 WP_003096769.1.91585 WP_003096769.1.91796 WP_003096769.1.9182 WP_003096769.1.91838 WP_003096769.1.91846 WP_003096769.1.91860 WP_003096769.1.91862 WP_003096769.1.91882 WP_003096769.1.9191 WP_003096769.1.91938 WP_003096769.1.91943 WP_003096769.1.91996 WP_003096769.1.92175 WP_003096769.1.9219 WP_003096769.1.92314 WP_003096769.1.92321 WP_003096769.1.92357 WP_003096769.1.92573 WP_003096769.1.92585 WP_003096769.1.92587 WP_003096769.1.92589 WP_003096769.1.92594 WP_003096769.1.92624 WP_003096769.1.92630 WP_003096769.1.92642 WP_003096769.1.9272 WP_003096769.1.92759 WP_003096769.1.92769 WP_003096769.1.92839 WP_003096769.1.92847 WP_003096769.1.92894 WP_003096769.1.92924 WP_003096769.1.92930 WP_003096769.1.92974 WP_003096769.1.93001 WP_003096769.1.93090 WP_003096769.1.93122 WP_003096769.1.93130 WP_003096769.1.93144 WP_003096769.1.93148 WP_003096769.1.93196 WP_003096769.1.93250 WP_003096769.1.9328 WP_003096769.1.93446 WP_003096769.1.9349 WP_003096769.1.93493 WP_003096769.1.93498 WP_003096769.1.93520 WP_003096769.1.93547 WP_003096769.1.93568 WP_003096769.1.93797 WP_003096769.1.93848 WP_003096769.1.93889 WP_003096769.1.93897 WP_003096769.1.94004 WP_003096769.1.94065 WP_003096769.1.94078 WP_003096769.1.94136 WP_003096769.1.94174 WP_003096769.1.94211 WP_003096769.1.94218 WP_003096769.1.94243 WP_003096769.1.94285 WP_003096769.1.94288 WP_003096769.1.94333 WP_003096769.1.94349 WP_003096769.1.94385 WP_003096769.1.94434 WP_003096769.1.9444 WP_003096769.1.94682 WP_003096769.1.94732 WP_003096769.1.94742 WP_003096769.1.94814 WP_003096769.1.94818 WP_003096769.1.94856 WP_003096769.1.94874 WP_003096769.1.94881 WP_003096769.1.94896 WP_003096769.1.94943 WP_003096769.1.95018 WP_003096769.1.95025 WP_003096769.1.95027 WP_003096769.1.95056 WP_003096769.1.95117 WP_003096769.1.95132 WP_003096769.1.95187 WP_003096769.1.95207 WP_003096769.1.95217 WP_003096769.1.95305 WP_003096769.1.95324 WP_003096769.1.95354 WP_003096769.1.95359 WP_003096769.1.95460 WP_003096769.1.95488 WP_003096769.1.95525 WP_003096769.1.95638 WP_003096769.1.95774 WP_003096769.1.95782 WP_003096769.1.95802 WP_003096769.1.95820 WP_003096769.1.95825 WP_003096769.1.95959 WP_003096769.1.9599 WP_003096769.1.95994 WP_003096769.1.95999 WP_003096769.1.96008 WP_003096769.1.9604 WP_003096769.1.96041 WP_003096769.1.96058 WP_003096769.1.961 WP_003096769.1.96134 WP_003096769.1.96193 WP_003096769.1.96243 WP_003096769.1.96267 WP_003096769.1.96357 WP_003096769.1.96384 WP_003096769.1.96452 WP_003096769.1.96506 WP_003096769.1.96667 WP_003096769.1.96702 WP_003096769.1.96714 WP_003096769.1.96863 WP_003096769.1.96880 WP_003096769.1.96967 WP_003096769.1.97118 WP_003096769.1.97126 WP_003096769.1.97204 WP_003096769.1.97213 WP_003096769.1.9722 WP_003096769.1.97271 WP_003096769.1.97272 WP_003096769.1.97377 WP_003096769.1.97461 WP_003096769.1.97474 WP_003096769.1.97488 WP_003096769.1.97499 WP_003096769.1.97503 WP_003096769.1.97521 WP_003096769.1.97583 WP_003096769.1.97614 WP_003096769.1.977 WP_003096769.1.97784 WP_003096769.1.97826 WP_003096769.1.97877 WP_003096769.1.97968 WP_003096769.1.98260 WP_003096769.1.98276 WP_003096769.1.98308 WP_003096769.1.98410 WP_003096769.1.98414 WP_003096769.1.98433 WP_003096769.1.9845 WP_003096769.1.985 WP_003096769.1.98515 WP_003096769.1.98522 WP_003096769.1.98573 WP_003096769.1.98600 WP_003096769.1.98610 WP_003096769.1.98693 WP_003096769.1.98718 WP_003096769.1.98788 WP_003096769.1.98814 WP_003096769.1.9885 WP_003096769.1.98873 WP_003096769.1.98907 WP_003096769.1.98926 WP_003096769.1.98958 WP_003096769.1.98960 WP_003096769.1.98963 WP_003096769.1.99065 WP_003096769.1.99068 WP_003096769.1.99103 WP_003096769.1.99214 WP_003096769.1.99293 WP_003096769.1.99378 WP_003096769.1.99386 WP_003096769.1.99389 WP_003096769.1.99443 WP_003096769.1.99461 WP_003096769.1.9951 WP_003096769.1.99516 WP_003096769.1.99647 WP_003096769.1.99654 WP_003096769.1.99662 WP_003096769.1.99746 WP_003096769.1.99757 WP_003096769.1.99772 WP_003096769.1.99795 WP_003096769.1.99835 WP_003096769.1.9989 WP_003096769.1.99930 208963.PA14_71420 208964.PA5411 381754.PSPA7_6200 557722.PLES_58071 gi|152987321|ref|YP_001351510.1| gi|218894515|ref|YP_002443385.1| gi|564955805|ref|YP_008888375.1| gi|514412513|ref|YP_008136071.1| gi|568156942|ref|YP_008945935.1| gi|15600604|ref|NP_254098.1| gi|558675598|ref|YP_008812306.1| gi|478481871|ref|YP_007712522.1| gi|558669247|ref|YP_008805957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]