SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568157063|ref|YP_008946056.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568157063|ref|YP_008946056.1|
Domain Number 1 Region: 256-337
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.31e-24
Family TonB 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568157063|ref|YP_008946056.1|
Sequence length 343
Comment cell envelope biogenesis protein TonB [Pseudomonas aeruginosa LES431]
Sequence
MSPQPSRSPDRFSLAALAEDHPTAPAQGDESESLPCVNAQRGEPNLRVVDCSGARRDEEV
AVEEVLIPYAHGSDPEDVPGEPPKSRWWLSSGAAVAMHVAIIGALVWVMPTPAELNLGHG
ELPKTMQVNFVQLEKKAEPTPQPPAAAPEPTPPKIEEPKPEPPKPKPVEKPKPKPKPKPK
PVENAIPKAKPKPEPKPKPEPEPSTEASSQPSPSSAAPPPPAPTVGQSTPGAQTAPSGSQ
GPAGLPSGSLNDSDIKPLRMDPPVYPRMAQARGIEGRVKVLFTITSDGRIDDIQVLESVP
SRMFDREVRQAMAKWRFEPRVSGGKIVARQATKMFFFKIEKRR
Download sequence
Identical sequences A0A069PY58 A0A0H3QMZ7 A0A1E9C9D3 A0A1F0IUH1 A0A1G5L604 A0A1S1BXZ0
gi|386061710|ref|YP_005978232.1| gi|514412628|ref|YP_008136191.1| gi|218894634|ref|YP_002443504.1| gi|558669369|ref|YP_008806079.1| 557722.PLES_59271 gi|558675720|ref|YP_008812428.1| gi|568157063|ref|YP_008946056.1| WP_003121399.1.100100 WP_003121399.1.100276 WP_003121399.1.100394 WP_003121399.1.100654 WP_003121399.1.100723 WP_003121399.1.100742 WP_003121399.1.100777 WP_003121399.1.100786 WP_003121399.1.100808 WP_003121399.1.100809 WP_003121399.1.100872 WP_003121399.1.100983 WP_003121399.1.101021 WP_003121399.1.101090 WP_003121399.1.101340 WP_003121399.1.101506 WP_003121399.1.101572 WP_003121399.1.101642 WP_003121399.1.101739 WP_003121399.1.10179 WP_003121399.1.101809 WP_003121399.1.101819 WP_003121399.1.10185 WP_003121399.1.101863 WP_003121399.1.101871 WP_003121399.1.10201 WP_003121399.1.10202 WP_003121399.1.10204 WP_003121399.1.10228 WP_003121399.1.10257 WP_003121399.1.10407 WP_003121399.1.10468 WP_003121399.1.10477 WP_003121399.1.10482 WP_003121399.1.10513 WP_003121399.1.10529 WP_003121399.1.10636 WP_003121399.1.10856 WP_003121399.1.10901 WP_003121399.1.10949 WP_003121399.1.11026 WP_003121399.1.11058 WP_003121399.1.1107 WP_003121399.1.1109 WP_003121399.1.11163 WP_003121399.1.11381 WP_003121399.1.11410 WP_003121399.1.11454 WP_003121399.1.11568 WP_003121399.1.11569 WP_003121399.1.11653 WP_003121399.1.1180 WP_003121399.1.1187 WP_003121399.1.11943 WP_003121399.1.12018 WP_003121399.1.12208 WP_003121399.1.12240 WP_003121399.1.12302 WP_003121399.1.12354 WP_003121399.1.1238 WP_003121399.1.12497 WP_003121399.1.12561 WP_003121399.1.12657 WP_003121399.1.12687 WP_003121399.1.12797 WP_003121399.1.12838 WP_003121399.1.12891 WP_003121399.1.12934 WP_003121399.1.12980 WP_003121399.1.13057 WP_003121399.1.13232 WP_003121399.1.13242 WP_003121399.1.13315 WP_003121399.1.1333 WP_003121399.1.13407 WP_003121399.1.13529 WP_003121399.1.13622 WP_003121399.1.13785 WP_003121399.1.13828 WP_003121399.1.13865 WP_003121399.1.1393 WP_003121399.1.14049 WP_003121399.1.14078 WP_003121399.1.14096 WP_003121399.1.14424 WP_003121399.1.14460 WP_003121399.1.14640 WP_003121399.1.14714 WP_003121399.1.1475 WP_003121399.1.14754 WP_003121399.1.14835 WP_003121399.1.14839 WP_003121399.1.14966 WP_003121399.1.15004 WP_003121399.1.15130 WP_003121399.1.152 WP_003121399.1.15222 WP_003121399.1.15281 WP_003121399.1.15297 WP_003121399.1.15373 WP_003121399.1.15480 WP_003121399.1.15602 WP_003121399.1.15889 WP_003121399.1.15934 WP_003121399.1.16041 WP_003121399.1.16074 WP_003121399.1.16142 WP_003121399.1.16161 WP_003121399.1.162 WP_003121399.1.16239 WP_003121399.1.16267 WP_003121399.1.16279 WP_003121399.1.16419 WP_003121399.1.1646 WP_003121399.1.16660 WP_003121399.1.1670 WP_003121399.1.16782 WP_003121399.1.16788 WP_003121399.1.16801 WP_003121399.1.16808 WP_003121399.1.17022 WP_003121399.1.17353 WP_003121399.1.17354 WP_003121399.1.17370 WP_003121399.1.1739 WP_003121399.1.17397 WP_003121399.1.17697 WP_003121399.1.17890 WP_003121399.1.18052 WP_003121399.1.18117 WP_003121399.1.18199 WP_003121399.1.18493 WP_003121399.1.18728 WP_003121399.1.18769 WP_003121399.1.18852 WP_003121399.1.18911 WP_003121399.1.18930 WP_003121399.1.19260 WP_003121399.1.19269 WP_003121399.1.19376 WP_003121399.1.1938 WP_003121399.1.19552 WP_003121399.1.1971 WP_003121399.1.19711 WP_003121399.1.19741 WP_003121399.1.19931 WP_003121399.1.20024 WP_003121399.1.20070 WP_003121399.1.20125 WP_003121399.1.20134 WP_003121399.1.20216 WP_003121399.1.20342 WP_003121399.1.20929 WP_003121399.1.21100 WP_003121399.1.21166 WP_003121399.1.21302 WP_003121399.1.21358 WP_003121399.1.2144 WP_003121399.1.21460 WP_003121399.1.21469 WP_003121399.1.21471 WP_003121399.1.21517 WP_003121399.1.21607 WP_003121399.1.21718 WP_003121399.1.21782 WP_003121399.1.21801 WP_003121399.1.22078 WP_003121399.1.2228 WP_003121399.1.22324 WP_003121399.1.22365 WP_003121399.1.22394 WP_003121399.1.22442 WP_003121399.1.22491 WP_003121399.1.22671 WP_003121399.1.22704 WP_003121399.1.22729 WP_003121399.1.22863 WP_003121399.1.2289 WP_003121399.1.23195 WP_003121399.1.23331 WP_003121399.1.23394 WP_003121399.1.23512 WP_003121399.1.23523 WP_003121399.1.23525 WP_003121399.1.23559 WP_003121399.1.23581 WP_003121399.1.23611 WP_003121399.1.23715 WP_003121399.1.23739 WP_003121399.1.23769 WP_003121399.1.23782 WP_003121399.1.23794 WP_003121399.1.23967 WP_003121399.1.23983 WP_003121399.1.24066 WP_003121399.1.24351 WP_003121399.1.24447 WP_003121399.1.24662 WP_003121399.1.2477 WP_003121399.1.24851 WP_003121399.1.24862 WP_003121399.1.24869 WP_003121399.1.25033 WP_003121399.1.25052 WP_003121399.1.25067 WP_003121399.1.25075 WP_003121399.1.251 WP_003121399.1.25142 WP_003121399.1.25179 WP_003121399.1.25191 WP_003121399.1.25271 WP_003121399.1.2529 WP_003121399.1.25328 WP_003121399.1.25344 WP_003121399.1.2535 WP_003121399.1.25600 WP_003121399.1.25695 WP_003121399.1.2572 WP_003121399.1.25903 WP_003121399.1.25964 WP_003121399.1.26042 WP_003121399.1.26159 WP_003121399.1.26334 WP_003121399.1.26428 WP_003121399.1.26463 WP_003121399.1.2652 WP_003121399.1.26592 WP_003121399.1.26604 WP_003121399.1.26681 WP_003121399.1.26682 WP_003121399.1.26705 WP_003121399.1.26740 WP_003121399.1.26841 WP_003121399.1.26906 WP_003121399.1.26967 WP_003121399.1.2698 WP_003121399.1.27107 WP_003121399.1.27218 WP_003121399.1.27505 WP_003121399.1.27575 WP_003121399.1.27587 WP_003121399.1.27687 WP_003121399.1.27837 WP_003121399.1.27858 WP_003121399.1.27939 WP_003121399.1.27966 WP_003121399.1.28136 WP_003121399.1.28175 WP_003121399.1.283 WP_003121399.1.28316 WP_003121399.1.28329 WP_003121399.1.28372 WP_003121399.1.28383 WP_003121399.1.28404 WP_003121399.1.28528 WP_003121399.1.28560 WP_003121399.1.28602 WP_003121399.1.28623 WP_003121399.1.28823 WP_003121399.1.28838 WP_003121399.1.28920 WP_003121399.1.29158 WP_003121399.1.29179 WP_003121399.1.2927 WP_003121399.1.2941 WP_003121399.1.29438 WP_003121399.1.2948 WP_003121399.1.29481 WP_003121399.1.29498 WP_003121399.1.29501 WP_003121399.1.29577 WP_003121399.1.2961 WP_003121399.1.29668 WP_003121399.1.29753 WP_003121399.1.29767 WP_003121399.1.2980 WP_003121399.1.29848 WP_003121399.1.30000 WP_003121399.1.30081 WP_003121399.1.30120 WP_003121399.1.30254 WP_003121399.1.30365 WP_003121399.1.30475 WP_003121399.1.30614 WP_003121399.1.3072 WP_003121399.1.30740 WP_003121399.1.30797 WP_003121399.1.30815 WP_003121399.1.30994 WP_003121399.1.31076 WP_003121399.1.31103 WP_003121399.1.31147 WP_003121399.1.31279 WP_003121399.1.31361 WP_003121399.1.31501 WP_003121399.1.31565 WP_003121399.1.31741 WP_003121399.1.3179 WP_003121399.1.3189 WP_003121399.1.31939 WP_003121399.1.32134 WP_003121399.1.32144 WP_003121399.1.32289 WP_003121399.1.32314 WP_003121399.1.32523 WP_003121399.1.32544 WP_003121399.1.32637 WP_003121399.1.32711 WP_003121399.1.32869 WP_003121399.1.32879 WP_003121399.1.33186 WP_003121399.1.33204 WP_003121399.1.33210 WP_003121399.1.33517 WP_003121399.1.33521 WP_003121399.1.33523 WP_003121399.1.33549 WP_003121399.1.33653 WP_003121399.1.33733 WP_003121399.1.33734 WP_003121399.1.3376 WP_003121399.1.33774 WP_003121399.1.33822 WP_003121399.1.33824 WP_003121399.1.34039 WP_003121399.1.34136 WP_003121399.1.34151 WP_003121399.1.34191 WP_003121399.1.34317 WP_003121399.1.34324 WP_003121399.1.34401 WP_003121399.1.34402 WP_003121399.1.34472 WP_003121399.1.34625 WP_003121399.1.34670 WP_003121399.1.34689 WP_003121399.1.34784 WP_003121399.1.34821 WP_003121399.1.34832 WP_003121399.1.34836 WP_003121399.1.34837 WP_003121399.1.34901 WP_003121399.1.34922 WP_003121399.1.35036 WP_003121399.1.35104 WP_003121399.1.35231 WP_003121399.1.35281 WP_003121399.1.3531 WP_003121399.1.35325 WP_003121399.1.35353 WP_003121399.1.3540 WP_003121399.1.35431 WP_003121399.1.35512 WP_003121399.1.35573 WP_003121399.1.35599 WP_003121399.1.35639 WP_003121399.1.35679 WP_003121399.1.3568 WP_003121399.1.3576 WP_003121399.1.35822 WP_003121399.1.35843 WP_003121399.1.35857 WP_003121399.1.36378 WP_003121399.1.3653 WP_003121399.1.3662 WP_003121399.1.36630 WP_003121399.1.36665 WP_003121399.1.36781 WP_003121399.1.36879 WP_003121399.1.37125 WP_003121399.1.37208 WP_003121399.1.37216 WP_003121399.1.37319 WP_003121399.1.37500 WP_003121399.1.37512 WP_003121399.1.3781 WP_003121399.1.3792 WP_003121399.1.38003 WP_003121399.1.38087 WP_003121399.1.38102 WP_003121399.1.38186 WP_003121399.1.3821 WP_003121399.1.38319 WP_003121399.1.3833 WP_003121399.1.38337 WP_003121399.1.38406 WP_003121399.1.38430 WP_003121399.1.38502 WP_003121399.1.38657 WP_003121399.1.38727 WP_003121399.1.38834 WP_003121399.1.38971 WP_003121399.1.39088 WP_003121399.1.39122 WP_003121399.1.3943 WP_003121399.1.39452 WP_003121399.1.39704 WP_003121399.1.39811 WP_003121399.1.3998 WP_003121399.1.39989 WP_003121399.1.40135 WP_003121399.1.40207 WP_003121399.1.40419 WP_003121399.1.40513 WP_003121399.1.40541 WP_003121399.1.40546 WP_003121399.1.4058 WP_003121399.1.40595 WP_003121399.1.40703 WP_003121399.1.40874 WP_003121399.1.40950 WP_003121399.1.40994 WP_003121399.1.41291 WP_003121399.1.41384 WP_003121399.1.41618 WP_003121399.1.41624 WP_003121399.1.41692 WP_003121399.1.41748 WP_003121399.1.41888 WP_003121399.1.4190 WP_003121399.1.41939 WP_003121399.1.42019 WP_003121399.1.42259 WP_003121399.1.42423 WP_003121399.1.42634 WP_003121399.1.42643 WP_003121399.1.42696 WP_003121399.1.42754 WP_003121399.1.42778 WP_003121399.1.42789 WP_003121399.1.42856 WP_003121399.1.42917 WP_003121399.1.42946 WP_003121399.1.42952 WP_003121399.1.42972 WP_003121399.1.42973 WP_003121399.1.43024 WP_003121399.1.43026 WP_003121399.1.43106 WP_003121399.1.43107 WP_003121399.1.43293 WP_003121399.1.43330 WP_003121399.1.4348 WP_003121399.1.43593 WP_003121399.1.43603 WP_003121399.1.43662 WP_003121399.1.43667 WP_003121399.1.43673 WP_003121399.1.43783 WP_003121399.1.43826 WP_003121399.1.44046 WP_003121399.1.44094 WP_003121399.1.44373 WP_003121399.1.44434 WP_003121399.1.445 WP_003121399.1.44563 WP_003121399.1.44739 WP_003121399.1.4493 WP_003121399.1.44959 WP_003121399.1.45063 WP_003121399.1.45090 WP_003121399.1.45146 WP_003121399.1.45202 WP_003121399.1.4522 WP_003121399.1.45228 WP_003121399.1.4532 WP_003121399.1.45328 WP_003121399.1.45485 WP_003121399.1.45711 WP_003121399.1.45934 WP_003121399.1.45961 WP_003121399.1.46010 WP_003121399.1.46032 WP_003121399.1.46093 WP_003121399.1.461 WP_003121399.1.46152 WP_003121399.1.46200 WP_003121399.1.46436 WP_003121399.1.46502 WP_003121399.1.46826 WP_003121399.1.46846 WP_003121399.1.46866 WP_003121399.1.4699 WP_003121399.1.47150 WP_003121399.1.47155 WP_003121399.1.47158 WP_003121399.1.47251 WP_003121399.1.4726 WP_003121399.1.47296 WP_003121399.1.47312 WP_003121399.1.47480 WP_003121399.1.47527 WP_003121399.1.47645 WP_003121399.1.47774 WP_003121399.1.47970 WP_003121399.1.48024 WP_003121399.1.48094 WP_003121399.1.48141 WP_003121399.1.48172 WP_003121399.1.48178 WP_003121399.1.48334 WP_003121399.1.4836 WP_003121399.1.48378 WP_003121399.1.48545 WP_003121399.1.48546 WP_003121399.1.48820 WP_003121399.1.48870 WP_003121399.1.48961 WP_003121399.1.49135 WP_003121399.1.49266 WP_003121399.1.49277 WP_003121399.1.49360 WP_003121399.1.49416 WP_003121399.1.49500 WP_003121399.1.49842 WP_003121399.1.49998 WP_003121399.1.50176 WP_003121399.1.50180 WP_003121399.1.50222 WP_003121399.1.50242 WP_003121399.1.5043 WP_003121399.1.50567 WP_003121399.1.50668 WP_003121399.1.50682 WP_003121399.1.50734 WP_003121399.1.50814 WP_003121399.1.50989 WP_003121399.1.51035 WP_003121399.1.51136 WP_003121399.1.51141 WP_003121399.1.51183 WP_003121399.1.51185 WP_003121399.1.51267 WP_003121399.1.5132 WP_003121399.1.51538 WP_003121399.1.51585 WP_003121399.1.51682 WP_003121399.1.51847 WP_003121399.1.51889 WP_003121399.1.51937 WP_003121399.1.51943 WP_003121399.1.51976 WP_003121399.1.52043 WP_003121399.1.52146 WP_003121399.1.52152 WP_003121399.1.52244 WP_003121399.1.5226 WP_003121399.1.52326 WP_003121399.1.5235 WP_003121399.1.52355 WP_003121399.1.52449 WP_003121399.1.5260 WP_003121399.1.52690 WP_003121399.1.52697 WP_003121399.1.52810 WP_003121399.1.5294 WP_003121399.1.53070 WP_003121399.1.53267 WP_003121399.1.53287 WP_003121399.1.53351 WP_003121399.1.53371 WP_003121399.1.53427 WP_003121399.1.53486 WP_003121399.1.53719 WP_003121399.1.53726 WP_003121399.1.53826 WP_003121399.1.53948 WP_003121399.1.54078 WP_003121399.1.54090 WP_003121399.1.54133 WP_003121399.1.54140 WP_003121399.1.5427 WP_003121399.1.54497 WP_003121399.1.54571 WP_003121399.1.54742 WP_003121399.1.55089 WP_003121399.1.55478 WP_003121399.1.55543 WP_003121399.1.56013 WP_003121399.1.56145 WP_003121399.1.56171 WP_003121399.1.56188 WP_003121399.1.56196 WP_003121399.1.56348 WP_003121399.1.56452 WP_003121399.1.56474 WP_003121399.1.56475 WP_003121399.1.56623 WP_003121399.1.56632 WP_003121399.1.56768 WP_003121399.1.56797 WP_003121399.1.56808 WP_003121399.1.56819 WP_003121399.1.56837 WP_003121399.1.57005 WP_003121399.1.57131 WP_003121399.1.57140 WP_003121399.1.5731 WP_003121399.1.57460 WP_003121399.1.57480 WP_003121399.1.57566 WP_003121399.1.58019 WP_003121399.1.58056 WP_003121399.1.58162 WP_003121399.1.58183 WP_003121399.1.58228 WP_003121399.1.58294 WP_003121399.1.58436 WP_003121399.1.58482 WP_003121399.1.58689 WP_003121399.1.58785 WP_003121399.1.58838 WP_003121399.1.58845 WP_003121399.1.5889 WP_003121399.1.59076 WP_003121399.1.59099 WP_003121399.1.59176 WP_003121399.1.59246 WP_003121399.1.59249 WP_003121399.1.59250 WP_003121399.1.5937 WP_003121399.1.594 WP_003121399.1.59469 WP_003121399.1.59563 WP_003121399.1.59688 WP_003121399.1.59724 WP_003121399.1.59759 WP_003121399.1.59797 WP_003121399.1.59831 WP_003121399.1.59870 WP_003121399.1.60051 WP_003121399.1.60062 WP_003121399.1.60082 WP_003121399.1.60206 WP_003121399.1.60261 WP_003121399.1.60415 WP_003121399.1.60467 WP_003121399.1.60600 WP_003121399.1.60603 WP_003121399.1.60639 WP_003121399.1.60686 WP_003121399.1.607 WP_003121399.1.60979 WP_003121399.1.61122 WP_003121399.1.61191 WP_003121399.1.61222 WP_003121399.1.61366 WP_003121399.1.61493 WP_003121399.1.61549 WP_003121399.1.6173 WP_003121399.1.61943 WP_003121399.1.62010 WP_003121399.1.62035 WP_003121399.1.62186 WP_003121399.1.62211 WP_003121399.1.62396 WP_003121399.1.62410 WP_003121399.1.6242 WP_003121399.1.62516 WP_003121399.1.62534 WP_003121399.1.62635 WP_003121399.1.62688 WP_003121399.1.62701 WP_003121399.1.62704 WP_003121399.1.62716 WP_003121399.1.62772 WP_003121399.1.62834 WP_003121399.1.62917 WP_003121399.1.63041 WP_003121399.1.63124 WP_003121399.1.63193 WP_003121399.1.63196 WP_003121399.1.63369 WP_003121399.1.63634 WP_003121399.1.64198 WP_003121399.1.64309 WP_003121399.1.64329 WP_003121399.1.64433 WP_003121399.1.64591 WP_003121399.1.64748 WP_003121399.1.64799 WP_003121399.1.64854 WP_003121399.1.64880 WP_003121399.1.64885 WP_003121399.1.64983 WP_003121399.1.65009 WP_003121399.1.65092 WP_003121399.1.65095 WP_003121399.1.65099 WP_003121399.1.65196 WP_003121399.1.65197 WP_003121399.1.65227 WP_003121399.1.65237 WP_003121399.1.65285 WP_003121399.1.65316 WP_003121399.1.65334 WP_003121399.1.65335 WP_003121399.1.65337 WP_003121399.1.65549 WP_003121399.1.65588 WP_003121399.1.6589 WP_003121399.1.66062 WP_003121399.1.66165 WP_003121399.1.66277 WP_003121399.1.6629 WP_003121399.1.66345 WP_003121399.1.66348 WP_003121399.1.66364 WP_003121399.1.66410 WP_003121399.1.66526 WP_003121399.1.66634 WP_003121399.1.66721 WP_003121399.1.66892 WP_003121399.1.66931 WP_003121399.1.66945 WP_003121399.1.67010 WP_003121399.1.67188 WP_003121399.1.67192 WP_003121399.1.6734 WP_003121399.1.67388 WP_003121399.1.67531 WP_003121399.1.67545 WP_003121399.1.67686 WP_003121399.1.67755 WP_003121399.1.67948 WP_003121399.1.68000 WP_003121399.1.6808 WP_003121399.1.68158 WP_003121399.1.68162 WP_003121399.1.68183 WP_003121399.1.68317 WP_003121399.1.6850 WP_003121399.1.68541 WP_003121399.1.68561 WP_003121399.1.68568 WP_003121399.1.68638 WP_003121399.1.6866 WP_003121399.1.68781 WP_003121399.1.68800 WP_003121399.1.68862 WP_003121399.1.68910 WP_003121399.1.69088 WP_003121399.1.6928 WP_003121399.1.6931 WP_003121399.1.69534 WP_003121399.1.69599 WP_003121399.1.69788 WP_003121399.1.69791 WP_003121399.1.69819 WP_003121399.1.69907 WP_003121399.1.70092 WP_003121399.1.70194 WP_003121399.1.70216 WP_003121399.1.70229 WP_003121399.1.70460 WP_003121399.1.70561 WP_003121399.1.70648 WP_003121399.1.70670 WP_003121399.1.70831 WP_003121399.1.70991 WP_003121399.1.71385 WP_003121399.1.71666 WP_003121399.1.71799 WP_003121399.1.71822 WP_003121399.1.71891 WP_003121399.1.71934 WP_003121399.1.72149 WP_003121399.1.72181 WP_003121399.1.72323 WP_003121399.1.72331 WP_003121399.1.72346 WP_003121399.1.72378 WP_003121399.1.72447 WP_003121399.1.72541 WP_003121399.1.72570 WP_003121399.1.72669 WP_003121399.1.7276 WP_003121399.1.7308 WP_003121399.1.73135 WP_003121399.1.73149 WP_003121399.1.7329 WP_003121399.1.733 WP_003121399.1.73490 WP_003121399.1.73523 WP_003121399.1.73541 WP_003121399.1.73791 WP_003121399.1.7382 WP_003121399.1.73860 WP_003121399.1.73889 WP_003121399.1.73911 WP_003121399.1.73941 WP_003121399.1.74000 WP_003121399.1.74072 WP_003121399.1.74074 WP_003121399.1.74106 WP_003121399.1.74167 WP_003121399.1.74175 WP_003121399.1.74180 WP_003121399.1.74268 WP_003121399.1.7445 WP_003121399.1.74518 WP_003121399.1.74604 WP_003121399.1.74629 WP_003121399.1.74772 WP_003121399.1.748 WP_003121399.1.74948 WP_003121399.1.74958 WP_003121399.1.75041 WP_003121399.1.75277 WP_003121399.1.75303 WP_003121399.1.7547 WP_003121399.1.75599 WP_003121399.1.75771 WP_003121399.1.75792 WP_003121399.1.75825 WP_003121399.1.75826 WP_003121399.1.75860 WP_003121399.1.75935 WP_003121399.1.75938 WP_003121399.1.75947 WP_003121399.1.76092 WP_003121399.1.76145 WP_003121399.1.76355 WP_003121399.1.76399 WP_003121399.1.76441 WP_003121399.1.76467 WP_003121399.1.76484 WP_003121399.1.76633 WP_003121399.1.7666 WP_003121399.1.76791 WP_003121399.1.76922 WP_003121399.1.77235 WP_003121399.1.77238 WP_003121399.1.77286 WP_003121399.1.77490 WP_003121399.1.77566 WP_003121399.1.77574 WP_003121399.1.77750 WP_003121399.1.77769 WP_003121399.1.7779 WP_003121399.1.77819 WP_003121399.1.77834 WP_003121399.1.78112 WP_003121399.1.78158 WP_003121399.1.78280 WP_003121399.1.78380 WP_003121399.1.78430 WP_003121399.1.78437 WP_003121399.1.78623 WP_003121399.1.78669 WP_003121399.1.78693 WP_003121399.1.78795 WP_003121399.1.78810 WP_003121399.1.78926 WP_003121399.1.78947 WP_003121399.1.78954 WP_003121399.1.78986 WP_003121399.1.79007 WP_003121399.1.79053 WP_003121399.1.79177 WP_003121399.1.79193 WP_003121399.1.79357 WP_003121399.1.79429 WP_003121399.1.79431 WP_003121399.1.7945 WP_003121399.1.79463 WP_003121399.1.79507 WP_003121399.1.79544 WP_003121399.1.79601 WP_003121399.1.79631 WP_003121399.1.79788 WP_003121399.1.79862 WP_003121399.1.79986 WP_003121399.1.80033 WP_003121399.1.80087 WP_003121399.1.80306 WP_003121399.1.80535 WP_003121399.1.80627 WP_003121399.1.80632 WP_003121399.1.80644 WP_003121399.1.80645 WP_003121399.1.80846 WP_003121399.1.80892 WP_003121399.1.80929 WP_003121399.1.80931 WP_003121399.1.80938 WP_003121399.1.81081 WP_003121399.1.81082 WP_003121399.1.8110 WP_003121399.1.81331 WP_003121399.1.81482 WP_003121399.1.81487 WP_003121399.1.81581 WP_003121399.1.81591 WP_003121399.1.81742 WP_003121399.1.81748 WP_003121399.1.81784 WP_003121399.1.81802 WP_003121399.1.81816 WP_003121399.1.81834 WP_003121399.1.82117 WP_003121399.1.82178 WP_003121399.1.82260 WP_003121399.1.8227 WP_003121399.1.82310 WP_003121399.1.82312 WP_003121399.1.82328 WP_003121399.1.82334 WP_003121399.1.82442 WP_003121399.1.82487 WP_003121399.1.82580 WP_003121399.1.82604 WP_003121399.1.82620 WP_003121399.1.82643 WP_003121399.1.82710 WP_003121399.1.82864 WP_003121399.1.82887 WP_003121399.1.82936 WP_003121399.1.83025 WP_003121399.1.83131 WP_003121399.1.83213 WP_003121399.1.83463 WP_003121399.1.83534 WP_003121399.1.8357 WP_003121399.1.83637 WP_003121399.1.83715 WP_003121399.1.83946 WP_003121399.1.84003 WP_003121399.1.84008 WP_003121399.1.84162 WP_003121399.1.84174 WP_003121399.1.84177 WP_003121399.1.84203 WP_003121399.1.84271 WP_003121399.1.84297 WP_003121399.1.84374 WP_003121399.1.84439 WP_003121399.1.84538 WP_003121399.1.84589 WP_003121399.1.8484 WP_003121399.1.85018 WP_003121399.1.85028 WP_003121399.1.85220 WP_003121399.1.85298 WP_003121399.1.85357 WP_003121399.1.85446 WP_003121399.1.85633 WP_003121399.1.85788 WP_003121399.1.85910 WP_003121399.1.86002 WP_003121399.1.86055 WP_003121399.1.86058 WP_003121399.1.86125 WP_003121399.1.86287 WP_003121399.1.86386 WP_003121399.1.865 WP_003121399.1.86545 WP_003121399.1.86652 WP_003121399.1.86708 WP_003121399.1.86733 WP_003121399.1.86774 WP_003121399.1.86780 WP_003121399.1.86785 WP_003121399.1.86813 WP_003121399.1.86947 WP_003121399.1.86985 WP_003121399.1.87163 WP_003121399.1.8718 WP_003121399.1.87183 WP_003121399.1.8727 WP_003121399.1.87316 WP_003121399.1.87390 WP_003121399.1.87435 WP_003121399.1.8749 WP_003121399.1.87530 WP_003121399.1.87648 WP_003121399.1.87981 WP_003121399.1.87987 WP_003121399.1.88004 WP_003121399.1.88360 WP_003121399.1.88388 WP_003121399.1.88517 WP_003121399.1.88550 WP_003121399.1.88605 WP_003121399.1.88659 WP_003121399.1.88679 WP_003121399.1.88680 WP_003121399.1.88750 WP_003121399.1.88949 WP_003121399.1.88969 WP_003121399.1.89083 WP_003121399.1.8911 WP_003121399.1.89234 WP_003121399.1.89245 WP_003121399.1.89266 WP_003121399.1.89276 WP_003121399.1.89409 WP_003121399.1.8949 WP_003121399.1.89523 WP_003121399.1.89610 WP_003121399.1.89638 WP_003121399.1.89669 WP_003121399.1.8976 WP_003121399.1.89867 WP_003121399.1.89868 WP_003121399.1.89886 WP_003121399.1.90024 WP_003121399.1.90056 WP_003121399.1.90110 WP_003121399.1.90150 WP_003121399.1.90189 WP_003121399.1.90224 WP_003121399.1.90225 WP_003121399.1.90268 WP_003121399.1.9056 WP_003121399.1.90655 WP_003121399.1.90770 WP_003121399.1.90940 WP_003121399.1.90999 WP_003121399.1.91093 WP_003121399.1.91161 WP_003121399.1.91204 WP_003121399.1.91336 WP_003121399.1.91416 WP_003121399.1.91431 WP_003121399.1.91438 WP_003121399.1.91563 WP_003121399.1.91803 WP_003121399.1.91838 WP_003121399.1.91846 WP_003121399.1.91860 WP_003121399.1.9191 WP_003121399.1.91938 WP_003121399.1.92314 WP_003121399.1.92321 WP_003121399.1.92454 WP_003121399.1.92585 WP_003121399.1.92587 WP_003121399.1.92624 WP_003121399.1.92642 WP_003121399.1.92769 WP_003121399.1.92839 WP_003121399.1.92847 WP_003121399.1.92894 WP_003121399.1.92930 WP_003121399.1.93144 WP_003121399.1.93148 WP_003121399.1.9349 WP_003121399.1.93498 WP_003121399.1.93797 WP_003121399.1.93848 WP_003121399.1.93897 WP_003121399.1.94136 WP_003121399.1.94174 WP_003121399.1.94211 WP_003121399.1.94218 WP_003121399.1.94221 WP_003121399.1.94243 WP_003121399.1.94285 WP_003121399.1.94385 WP_003121399.1.94814 WP_003121399.1.94856 WP_003121399.1.94896 WP_003121399.1.94897 WP_003121399.1.95132 WP_003121399.1.95217 WP_003121399.1.95305 WP_003121399.1.95324 WP_003121399.1.95359 WP_003121399.1.95460 WP_003121399.1.95488 WP_003121399.1.95536 WP_003121399.1.95638 WP_003121399.1.95745 WP_003121399.1.95802 WP_003121399.1.95994 WP_003121399.1.95999 WP_003121399.1.9604 WP_003121399.1.96041 WP_003121399.1.96134 WP_003121399.1.96357 WP_003121399.1.96384 WP_003121399.1.96434 WP_003121399.1.96452 WP_003121399.1.96506 WP_003121399.1.96667 WP_003121399.1.96702 WP_003121399.1.96714 WP_003121399.1.96880 WP_003121399.1.96967 WP_003121399.1.9706 WP_003121399.1.97126 WP_003121399.1.97213 WP_003121399.1.9722 WP_003121399.1.97271 WP_003121399.1.97272 WP_003121399.1.977 WP_003121399.1.97877 WP_003121399.1.98308 WP_003121399.1.98433 WP_003121399.1.98515 WP_003121399.1.98522 WP_003121399.1.98573 WP_003121399.1.98672 WP_003121399.1.98788 WP_003121399.1.98814 WP_003121399.1.9885 WP_003121399.1.98926 WP_003121399.1.99068 WP_003121399.1.99214 WP_003121399.1.99353 WP_003121399.1.99386 WP_003121399.1.99389 WP_003121399.1.99516 WP_003121399.1.99654 WP_003121399.1.99662 WP_003121399.1.99746 WP_003121399.1.99757 WP_003121399.1.99795 WP_003121399.1.99835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]