SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568151941|ref|YP_008940888.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568151941|ref|YP_008940888.1|
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily YjgF-like 1.4e-35
Family YjgF/L-PSP 0.00000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568151941|ref|YP_008940888.1|
Sequence length 132
Comment endoribonuclease L-PSP [Pseudomonas aeruginosa LES431]
Sequence
MTVRDVVFPAGRQALYERNRYSPAVRSDGLLFVSGQVGSRDDGSPEPELETQVRRAFDNL
NAVLAAAGCGFDDVLDVTVFMVDAEANFERIWKIVPEYWGEAPYPTLTAVGVNWLYGFSF
EIKVVARLPEGR
Download sequence
Identical sequences A0A0C7AP36 A0A0H2ZG00 A0A157VSQ1 A0A1E9BZU9 A0A1F0IAD6 A0A1S1C5G7 Q9HWK8 W1MG18
gi|568151941|ref|YP_008940888.1| gi|116052215|ref|YP_788941.1| gi|558668001|ref|YP_008804711.1| gi|15599368|ref|NP_252862.1| gi|558674352|ref|YP_008811060.1| gi|514411343|ref|YP_008134806.1| gi|218889498|ref|YP_002438362.1| 208963.PA14_09920 208964.PA4173 557722.PLES_07541 NP_252862.1.87394 WP_003101334.1.100071 WP_003101334.1.100100 WP_003101334.1.100278 WP_003101334.1.100420 WP_003101334.1.100473 WP_003101334.1.100523 WP_003101334.1.100654 WP_003101334.1.100742 WP_003101334.1.100786 WP_003101334.1.100808 WP_003101334.1.100810 WP_003101334.1.100872 WP_003101334.1.100983 WP_003101334.1.100995 WP_003101334.1.101269 WP_003101334.1.101340 WP_003101334.1.101506 WP_003101334.1.101572 WP_003101334.1.101642 WP_003101334.1.101712 WP_003101334.1.10179 WP_003101334.1.101809 WP_003101334.1.10185 WP_003101334.1.101863 WP_003101334.1.101871 WP_003101334.1.10204 WP_003101334.1.102045 WP_003101334.1.10248 WP_003101334.1.10257 WP_003101334.1.1037 WP_003101334.1.10419 WP_003101334.1.10435 WP_003101334.1.10468 WP_003101334.1.10477 WP_003101334.1.10513 WP_003101334.1.10572 WP_003101334.1.10575 WP_003101334.1.10636 WP_003101334.1.10641 WP_003101334.1.10684 WP_003101334.1.10856 WP_003101334.1.10895 WP_003101334.1.10901 WP_003101334.1.11026 WP_003101334.1.11058 WP_003101334.1.1107 WP_003101334.1.11077 WP_003101334.1.11178 WP_003101334.1.11318 WP_003101334.1.11381 WP_003101334.1.11410 WP_003101334.1.11454 WP_003101334.1.11568 WP_003101334.1.11569 WP_003101334.1.11653 WP_003101334.1.11744 WP_003101334.1.11754 WP_003101334.1.1180 WP_003101334.1.11847 WP_003101334.1.1187 WP_003101334.1.11943 WP_003101334.1.12018 WP_003101334.1.12120 WP_003101334.1.12150 WP_003101334.1.12208 WP_003101334.1.12240 WP_003101334.1.12302 WP_003101334.1.12354 WP_003101334.1.12400 WP_003101334.1.12482 WP_003101334.1.12497 WP_003101334.1.12530 WP_003101334.1.12547 WP_003101334.1.12561 WP_003101334.1.12670 WP_003101334.1.12797 WP_003101334.1.12838 WP_003101334.1.12873 WP_003101334.1.12922 WP_003101334.1.12934 WP_003101334.1.12970 WP_003101334.1.12980 WP_003101334.1.13 WP_003101334.1.13041 WP_003101334.1.1305 WP_003101334.1.13085 WP_003101334.1.13092 WP_003101334.1.13208 WP_003101334.1.13232 WP_003101334.1.13270 WP_003101334.1.13407 WP_003101334.1.13533 WP_003101334.1.1356 WP_003101334.1.1362 WP_003101334.1.13622 WP_003101334.1.13718 WP_003101334.1.13743 WP_003101334.1.13758 WP_003101334.1.13765 WP_003101334.1.13785 WP_003101334.1.13828 WP_003101334.1.1393 WP_003101334.1.14078 WP_003101334.1.14096 WP_003101334.1.14204 WP_003101334.1.14251 WP_003101334.1.14378 WP_003101334.1.14460 WP_003101334.1.14525 WP_003101334.1.14615 WP_003101334.1.14640 WP_003101334.1.14714 WP_003101334.1.1475 WP_003101334.1.14815 WP_003101334.1.14820 WP_003101334.1.14966 WP_003101334.1.15130 WP_003101334.1.15222 WP_003101334.1.15231 WP_003101334.1.15281 WP_003101334.1.15474 WP_003101334.1.15480 WP_003101334.1.15482 WP_003101334.1.15485 WP_003101334.1.15692 WP_003101334.1.15886 WP_003101334.1.15889 WP_003101334.1.16041 WP_003101334.1.16109 WP_003101334.1.16142 WP_003101334.1.16197 WP_003101334.1.16242 WP_003101334.1.16267 WP_003101334.1.16279 WP_003101334.1.16419 WP_003101334.1.1646 WP_003101334.1.1670 WP_003101334.1.1671 WP_003101334.1.16751 WP_003101334.1.16782 WP_003101334.1.16811 WP_003101334.1.16895 WP_003101334.1.17022 WP_003101334.1.17108 WP_003101334.1.17155 WP_003101334.1.17162 WP_003101334.1.17177 WP_003101334.1.17223 WP_003101334.1.17354 WP_003101334.1.17566 WP_003101334.1.1761 WP_003101334.1.17883 WP_003101334.1.18052 WP_003101334.1.18117 WP_003101334.1.18156 WP_003101334.1.18157 WP_003101334.1.18199 WP_003101334.1.18204 WP_003101334.1.18234 WP_003101334.1.18349 WP_003101334.1.18440 WP_003101334.1.18493 WP_003101334.1.18508 WP_003101334.1.18653 WP_003101334.1.18728 WP_003101334.1.18735 WP_003101334.1.18769 WP_003101334.1.18795 WP_003101334.1.18852 WP_003101334.1.18892 WP_003101334.1.18907 WP_003101334.1.18930 WP_003101334.1.190 WP_003101334.1.19089 WP_003101334.1.19199 WP_003101334.1.19251 WP_003101334.1.19260 WP_003101334.1.19351 WP_003101334.1.19376 WP_003101334.1.19591 WP_003101334.1.19640 WP_003101334.1.19703 WP_003101334.1.19718 WP_003101334.1.19741 WP_003101334.1.19771 WP_003101334.1.19931 WP_003101334.1.20024 WP_003101334.1.20070 WP_003101334.1.2012 WP_003101334.1.20134 WP_003101334.1.20342 WP_003101334.1.20682 WP_003101334.1.20692 WP_003101334.1.20744 WP_003101334.1.20764 WP_003101334.1.20825 WP_003101334.1.20854 WP_003101334.1.20880 WP_003101334.1.20884 WP_003101334.1.20890 WP_003101334.1.209 WP_003101334.1.20929 WP_003101334.1.21039 WP_003101334.1.21096 WP_003101334.1.21242 WP_003101334.1.21253 WP_003101334.1.21302 WP_003101334.1.21349 WP_003101334.1.21448 WP_003101334.1.21471 WP_003101334.1.21517 WP_003101334.1.21607 WP_003101334.1.2172 WP_003101334.1.21744 WP_003101334.1.21801 WP_003101334.1.21863 WP_003101334.1.21871 WP_003101334.1.21891 WP_003101334.1.21932 WP_003101334.1.221 WP_003101334.1.22365 WP_003101334.1.22390 WP_003101334.1.22394 WP_003101334.1.22477 WP_003101334.1.22491 WP_003101334.1.22573 WP_003101334.1.22704 WP_003101334.1.22729 WP_003101334.1.22863 WP_003101334.1.2289 WP_003101334.1.22891 WP_003101334.1.23013 WP_003101334.1.23195 WP_003101334.1.23264 WP_003101334.1.23331 WP_003101334.1.23394 WP_003101334.1.23418 WP_003101334.1.23421 WP_003101334.1.23512 WP_003101334.1.23523 WP_003101334.1.23525 WP_003101334.1.23581 WP_003101334.1.23611 WP_003101334.1.23641 WP_003101334.1.23715 WP_003101334.1.23794 WP_003101334.1.23884 WP_003101334.1.23925 WP_003101334.1.23961 WP_003101334.1.23967 WP_003101334.1.23983 WP_003101334.1.24066 WP_003101334.1.24077 WP_003101334.1.24087 WP_003101334.1.24183 WP_003101334.1.24234 WP_003101334.1.24351 WP_003101334.1.24382 WP_003101334.1.24413 WP_003101334.1.2453 WP_003101334.1.24662 WP_003101334.1.2477 WP_003101334.1.24862 WP_003101334.1.24869 WP_003101334.1.24879 WP_003101334.1.24938 WP_003101334.1.25033 WP_003101334.1.25052 WP_003101334.1.25067 WP_003101334.1.251 WP_003101334.1.25109 WP_003101334.1.25142 WP_003101334.1.25149 WP_003101334.1.2530 WP_003101334.1.25348 WP_003101334.1.25532 WP_003101334.1.25695 WP_003101334.1.2572 WP_003101334.1.2596 WP_003101334.1.26042 WP_003101334.1.261 WP_003101334.1.26159 WP_003101334.1.26334 WP_003101334.1.26428 WP_003101334.1.26463 WP_003101334.1.26489 WP_003101334.1.2652 WP_003101334.1.26539 WP_003101334.1.26604 WP_003101334.1.26681 WP_003101334.1.26705 WP_003101334.1.26816 WP_003101334.1.26841 WP_003101334.1.26862 WP_003101334.1.26906 WP_003101334.1.26967 WP_003101334.1.2698 WP_003101334.1.27018 WP_003101334.1.27211 WP_003101334.1.27259 WP_003101334.1.27505 WP_003101334.1.27534 WP_003101334.1.27587 WP_003101334.1.27738 WP_003101334.1.27783 WP_003101334.1.27837 WP_003101334.1.27939 WP_003101334.1.27966 WP_003101334.1.28006 WP_003101334.1.28057 WP_003101334.1.28064 WP_003101334.1.28078 WP_003101334.1.28258 WP_003101334.1.28316 WP_003101334.1.28329 WP_003101334.1.28372 WP_003101334.1.28382 WP_003101334.1.28383 WP_003101334.1.28404 WP_003101334.1.28468 WP_003101334.1.28528 WP_003101334.1.28560 WP_003101334.1.28602 WP_003101334.1.28623 WP_003101334.1.28699 WP_003101334.1.28757 WP_003101334.1.28800 WP_003101334.1.28823 WP_003101334.1.28838 WP_003101334.1.28849 WP_003101334.1.29003 WP_003101334.1.29096 WP_003101334.1.29127 WP_003101334.1.29137 WP_003101334.1.29179 WP_003101334.1.29208 WP_003101334.1.2927 WP_003101334.1.29401 WP_003101334.1.29472 WP_003101334.1.2948 WP_003101334.1.29498 WP_003101334.1.29753 WP_003101334.1.2980 WP_003101334.1.30000 WP_003101334.1.30120 WP_003101334.1.30254 WP_003101334.1.30365 WP_003101334.1.30563 WP_003101334.1.30567 WP_003101334.1.30615 WP_003101334.1.30625 WP_003101334.1.30707 WP_003101334.1.30797 WP_003101334.1.30886 WP_003101334.1.30943 WP_003101334.1.30994 WP_003101334.1.31045 WP_003101334.1.31076 WP_003101334.1.31087 WP_003101334.1.31105 WP_003101334.1.31138 WP_003101334.1.31147 WP_003101334.1.31279 WP_003101334.1.31361 WP_003101334.1.31457 WP_003101334.1.31563 WP_003101334.1.31565 WP_003101334.1.31655 WP_003101334.1.31741 WP_003101334.1.3179 WP_003101334.1.31848 WP_003101334.1.31852 WP_003101334.1.3189 WP_003101334.1.31939 WP_003101334.1.32134 WP_003101334.1.32137 WP_003101334.1.32289 WP_003101334.1.32359 WP_003101334.1.32447 WP_003101334.1.32544 WP_003101334.1.32596 WP_003101334.1.32711 WP_003101334.1.32821 WP_003101334.1.32869 WP_003101334.1.32879 WP_003101334.1.33009 WP_003101334.1.33047 WP_003101334.1.33133 WP_003101334.1.33152 WP_003101334.1.33186 WP_003101334.1.33204 WP_003101334.1.33210 WP_003101334.1.33216 WP_003101334.1.33294 WP_003101334.1.33340 WP_003101334.1.33387 WP_003101334.1.33438 WP_003101334.1.33441 WP_003101334.1.33523 WP_003101334.1.33549 WP_003101334.1.33653 WP_003101334.1.33658 WP_003101334.1.33669 WP_003101334.1.3368 WP_003101334.1.33733 WP_003101334.1.33774 WP_003101334.1.33814 WP_003101334.1.33822 WP_003101334.1.33824 WP_003101334.1.33833 WP_003101334.1.34000 WP_003101334.1.34039 WP_003101334.1.34136 WP_003101334.1.34151 WP_003101334.1.34306 WP_003101334.1.3436 WP_003101334.1.34402 WP_003101334.1.34461 WP_003101334.1.34465 WP_003101334.1.34472 WP_003101334.1.3452 WP_003101334.1.34556 WP_003101334.1.34568 WP_003101334.1.34625 WP_003101334.1.34689 WP_003101334.1.34784 WP_003101334.1.34821 WP_003101334.1.34832 WP_003101334.1.34836 WP_003101334.1.34837 WP_003101334.1.34878 WP_003101334.1.34901 WP_003101334.1.35036 WP_003101334.1.35104 WP_003101334.1.35149 WP_003101334.1.3531 WP_003101334.1.35325 WP_003101334.1.35431 WP_003101334.1.35442 WP_003101334.1.35480 WP_003101334.1.35573 WP_003101334.1.35599 WP_003101334.1.35639 WP_003101334.1.35641 WP_003101334.1.35669 WP_003101334.1.35679 WP_003101334.1.35682 WP_003101334.1.3576 WP_003101334.1.35762 WP_003101334.1.35768 WP_003101334.1.35857 WP_003101334.1.35872 WP_003101334.1.35984 WP_003101334.1.36064 WP_003101334.1.36148 WP_003101334.1.36170 WP_003101334.1.36267 WP_003101334.1.36378 WP_003101334.1.36435 WP_003101334.1.36521 WP_003101334.1.3653 WP_003101334.1.36587 WP_003101334.1.36608 WP_003101334.1.36665 WP_003101334.1.36708 WP_003101334.1.36781 WP_003101334.1.36879 WP_003101334.1.37097 WP_003101334.1.37125 WP_003101334.1.37163 WP_003101334.1.37208 WP_003101334.1.3721 WP_003101334.1.373 WP_003101334.1.37319 WP_003101334.1.37500 WP_003101334.1.37571 WP_003101334.1.37703 WP_003101334.1.3781 WP_003101334.1.37814 WP_003101334.1.37826 WP_003101334.1.37842 WP_003101334.1.3785 WP_003101334.1.3792 WP_003101334.1.38003 WP_003101334.1.38023 WP_003101334.1.38087 WP_003101334.1.38146 WP_003101334.1.38151 WP_003101334.1.3818 WP_003101334.1.38186 WP_003101334.1.3821 WP_003101334.1.38319 WP_003101334.1.3833 WP_003101334.1.38337 WP_003101334.1.38450 WP_003101334.1.38502 WP_003101334.1.38505 WP_003101334.1.38510 WP_003101334.1.38582 WP_003101334.1.38583 WP_003101334.1.38587 WP_003101334.1.38657 WP_003101334.1.38661 WP_003101334.1.3870 WP_003101334.1.38816 WP_003101334.1.38889 WP_003101334.1.38971 WP_003101334.1.39046 WP_003101334.1.39088 WP_003101334.1.39122 WP_003101334.1.39186 WP_003101334.1.39271 WP_003101334.1.39326 WP_003101334.1.39345 WP_003101334.1.39444 WP_003101334.1.39458 WP_003101334.1.39704 WP_003101334.1.39765 WP_003101334.1.39786 WP_003101334.1.39811 WP_003101334.1.39949 WP_003101334.1.3998 WP_003101334.1.39989 WP_003101334.1.40059 WP_003101334.1.40135 WP_003101334.1.40207 WP_003101334.1.40213 WP_003101334.1.40243 WP_003101334.1.40419 WP_003101334.1.40442 WP_003101334.1.40512 WP_003101334.1.40541 WP_003101334.1.40546 WP_003101334.1.40874 WP_003101334.1.40950 WP_003101334.1.40984 WP_003101334.1.40993 WP_003101334.1.40994 WP_003101334.1.41110 WP_003101334.1.41291 WP_003101334.1.41301 WP_003101334.1.41429 WP_003101334.1.41502 WP_003101334.1.4156 WP_003101334.1.41618 WP_003101334.1.41625 WP_003101334.1.41692 WP_003101334.1.41703 WP_003101334.1.41732 WP_003101334.1.41773 WP_003101334.1.41832 WP_003101334.1.41846 WP_003101334.1.41871 WP_003101334.1.41888 WP_003101334.1.4190 WP_003101334.1.4196 WP_003101334.1.42 WP_003101334.1.42041 WP_003101334.1.42146 WP_003101334.1.42259 WP_003101334.1.42294 WP_003101334.1.42316 WP_003101334.1.42411 WP_003101334.1.42463 WP_003101334.1.42499 WP_003101334.1.42508 WP_003101334.1.42634 WP_003101334.1.42643 WP_003101334.1.42757 WP_003101334.1.42778 WP_003101334.1.42854 WP_003101334.1.42870 WP_003101334.1.42952 WP_003101334.1.42972 WP_003101334.1.42973 WP_003101334.1.43024 WP_003101334.1.43049 WP_003101334.1.43106 WP_003101334.1.43107 WP_003101334.1.43286 WP_003101334.1.43293 WP_003101334.1.43330 WP_003101334.1.43356 WP_003101334.1.4348 WP_003101334.1.43662 WP_003101334.1.43673 WP_003101334.1.43729 WP_003101334.1.43756 WP_003101334.1.43802 WP_003101334.1.4381 WP_003101334.1.43826 WP_003101334.1.4397 WP_003101334.1.4398 WP_003101334.1.43998 WP_003101334.1.44046 WP_003101334.1.44094 WP_003101334.1.44213 WP_003101334.1.44260 WP_003101334.1.44373 WP_003101334.1.44486 WP_003101334.1.445 WP_003101334.1.44581 WP_003101334.1.44725 WP_003101334.1.44739 WP_003101334.1.44760 WP_003101334.1.4493 WP_003101334.1.45090 WP_003101334.1.45146 WP_003101334.1.45199 WP_003101334.1.45202 WP_003101334.1.4522 WP_003101334.1.45228 WP_003101334.1.45298 WP_003101334.1.45306 WP_003101334.1.45312 WP_003101334.1.4532 WP_003101334.1.45328 WP_003101334.1.45353 WP_003101334.1.45358 WP_003101334.1.45464 WP_003101334.1.45478 WP_003101334.1.45485 WP_003101334.1.45604 WP_003101334.1.45635 WP_003101334.1.45678 WP_003101334.1.45700 WP_003101334.1.45711 WP_003101334.1.45723 WP_003101334.1.45818 WP_003101334.1.45934 WP_003101334.1.46032 WP_003101334.1.461 WP_003101334.1.46152 WP_003101334.1.46200 WP_003101334.1.46306 WP_003101334.1.46436 WP_003101334.1.46502 WP_003101334.1.46623 WP_003101334.1.46633 WP_003101334.1.46755 WP_003101334.1.46885 WP_003101334.1.46926 WP_003101334.1.47101 WP_003101334.1.47158 WP_003101334.1.4726 WP_003101334.1.47296 WP_003101334.1.47312 WP_003101334.1.47314 WP_003101334.1.47480 WP_003101334.1.47527 WP_003101334.1.47774 WP_003101334.1.47930 WP_003101334.1.47970 WP_003101334.1.48001 WP_003101334.1.48024 WP_003101334.1.48086 WP_003101334.1.48172 WP_003101334.1.48178 WP_003101334.1.48321 WP_003101334.1.48334 WP_003101334.1.4836 WP_003101334.1.48378 WP_003101334.1.48382 WP_003101334.1.48413 WP_003101334.1.48472 WP_003101334.1.48474 WP_003101334.1.48545 WP_003101334.1.48820 WP_003101334.1.48842 WP_003101334.1.48851 WP_003101334.1.49108 WP_003101334.1.49135 WP_003101334.1.49244 WP_003101334.1.49265 WP_003101334.1.49266 WP_003101334.1.49286 WP_003101334.1.49293 WP_003101334.1.49416 WP_003101334.1.49557 WP_003101334.1.49688 WP_003101334.1.49798 WP_003101334.1.49806 WP_003101334.1.49833 WP_003101334.1.49842 WP_003101334.1.49948 WP_003101334.1.49976 WP_003101334.1.49988 WP_003101334.1.49998 WP_003101334.1.50176 WP_003101334.1.5043 WP_003101334.1.50459 WP_003101334.1.50567 WP_003101334.1.50653 WP_003101334.1.50665 WP_003101334.1.50668 WP_003101334.1.50682 WP_003101334.1.50734 WP_003101334.1.50783 WP_003101334.1.50922 WP_003101334.1.50967 WP_003101334.1.51019 WP_003101334.1.51136 WP_003101334.1.51141 WP_003101334.1.51173 WP_003101334.1.51183 WP_003101334.1.51267 WP_003101334.1.5132 WP_003101334.1.51457 WP_003101334.1.51538 WP_003101334.1.51807 WP_003101334.1.51847 WP_003101334.1.51928 WP_003101334.1.51937 WP_003101334.1.51957 WP_003101334.1.51976 WP_003101334.1.52220 WP_003101334.1.52326 WP_003101334.1.52334 WP_003101334.1.5235 WP_003101334.1.52409 WP_003101334.1.52449 WP_003101334.1.52500 WP_003101334.1.52537 WP_003101334.1.5258 WP_003101334.1.52583 WP_003101334.1.52690 WP_003101334.1.52697 WP_003101334.1.52700 WP_003101334.1.52784 WP_003101334.1.52850 WP_003101334.1.53070 WP_003101334.1.53072 WP_003101334.1.53169 WP_003101334.1.53267 WP_003101334.1.53351 WP_003101334.1.53371 WP_003101334.1.53427 WP_003101334.1.53528 WP_003101334.1.53530 WP_003101334.1.53663 WP_003101334.1.53678 WP_003101334.1.53726 WP_003101334.1.53932 WP_003101334.1.53948 WP_003101334.1.53951 WP_003101334.1.54003 WP_003101334.1.54090 WP_003101334.1.54140 WP_003101334.1.54146 WP_003101334.1.54248 WP_003101334.1.5427 WP_003101334.1.54354 WP_003101334.1.54462 WP_003101334.1.54497 WP_003101334.1.54571 WP_003101334.1.54809 WP_003101334.1.54974 WP_003101334.1.55089 WP_003101334.1.55169 WP_003101334.1.55347 WP_003101334.1.55387 WP_003101334.1.55400 WP_003101334.1.55543 WP_003101334.1.55729 WP_003101334.1.55813 WP_003101334.1.56013 WP_003101334.1.56187 WP_003101334.1.56228 WP_003101334.1.56229 WP_003101334.1.56315 WP_003101334.1.56442 WP_003101334.1.56465 WP_003101334.1.56623 WP_003101334.1.56626 WP_003101334.1.56745 WP_003101334.1.56768 WP_003101334.1.56797 WP_003101334.1.56808 WP_003101334.1.56819 WP_003101334.1.56837 WP_003101334.1.56973 WP_003101334.1.57020 WP_003101334.1.57113 WP_003101334.1.57276 WP_003101334.1.5731 WP_003101334.1.57369 WP_003101334.1.57480 WP_003101334.1.57548 WP_003101334.1.57792 WP_003101334.1.57841 WP_003101334.1.57853 WP_003101334.1.57966 WP_003101334.1.58019 WP_003101334.1.58183 WP_003101334.1.58193 WP_003101334.1.58200 WP_003101334.1.58360 WP_003101334.1.58417 WP_003101334.1.5850 WP_003101334.1.58510 WP_003101334.1.58800 WP_003101334.1.5889 WP_003101334.1.58944 WP_003101334.1.59013 WP_003101334.1.59076 WP_003101334.1.59099 WP_003101334.1.59176 WP_003101334.1.59212 WP_003101334.1.59246 WP_003101334.1.59376 WP_003101334.1.59688 WP_003101334.1.59759 WP_003101334.1.59797 WP_003101334.1.59831 WP_003101334.1.59870 WP_003101334.1.60051 WP_003101334.1.60079 WP_003101334.1.60084 WP_003101334.1.60085 WP_003101334.1.60206 WP_003101334.1.60261 WP_003101334.1.60364 WP_003101334.1.60396 WP_003101334.1.60415 WP_003101334.1.60472 WP_003101334.1.60509 WP_003101334.1.60602 WP_003101334.1.60603 WP_003101334.1.60639 WP_003101334.1.60679 WP_003101334.1.60686 WP_003101334.1.607 WP_003101334.1.60910 WP_003101334.1.60916 WP_003101334.1.60979 WP_003101334.1.61130 WP_003101334.1.61209 WP_003101334.1.61269 WP_003101334.1.61288 WP_003101334.1.61294 WP_003101334.1.6130 WP_003101334.1.61431 WP_003101334.1.61598 WP_003101334.1.61696 WP_003101334.1.6173 WP_003101334.1.61943 WP_003101334.1.62010 WP_003101334.1.62035 WP_003101334.1.62180 WP_003101334.1.62211 WP_003101334.1.62357 WP_003101334.1.6242 WP_003101334.1.62483 WP_003101334.1.62516 WP_003101334.1.62534 WP_003101334.1.626 WP_003101334.1.62604 WP_003101334.1.62635 WP_003101334.1.62688 WP_003101334.1.62701 WP_003101334.1.62703 WP_003101334.1.62716 WP_003101334.1.62768 WP_003101334.1.6280 WP_003101334.1.62834 WP_003101334.1.62873 WP_003101334.1.63041 WP_003101334.1.63057 WP_003101334.1.63124 WP_003101334.1.63193 WP_003101334.1.63196 WP_003101334.1.63338 WP_003101334.1.63401 WP_003101334.1.63597 WP_003101334.1.63634 WP_003101334.1.63659 WP_003101334.1.63739 WP_003101334.1.63995 WP_003101334.1.64155 WP_003101334.1.64212 WP_003101334.1.64329 WP_003101334.1.64340 WP_003101334.1.64433 WP_003101334.1.64544 WP_003101334.1.64603 WP_003101334.1.6461 WP_003101334.1.64726 WP_003101334.1.64748 WP_003101334.1.64799 WP_003101334.1.64807 WP_003101334.1.64854 WP_003101334.1.64862 WP_003101334.1.64880 WP_003101334.1.64885 WP_003101334.1.64886 WP_003101334.1.64984 WP_003101334.1.65066 WP_003101334.1.65092 WP_003101334.1.65095 WP_003101334.1.65099 WP_003101334.1.65145 WP_003101334.1.65196 WP_003101334.1.65227 WP_003101334.1.65237 WP_003101334.1.65247 WP_003101334.1.65285 WP_003101334.1.65312 WP_003101334.1.65316 WP_003101334.1.65334 WP_003101334.1.65335 WP_003101334.1.65457 WP_003101334.1.65632 WP_003101334.1.65642 WP_003101334.1.65740 WP_003101334.1.65819 WP_003101334.1.65867 WP_003101334.1.6589 WP_003101334.1.65926 WP_003101334.1.66155 WP_003101334.1.6627 WP_003101334.1.66348 WP_003101334.1.66364 WP_003101334.1.66526 WP_003101334.1.66634 WP_003101334.1.66721 WP_003101334.1.66892 WP_003101334.1.66929 WP_003101334.1.66931 WP_003101334.1.66945 WP_003101334.1.66950 WP_003101334.1.66982 WP_003101334.1.67188 WP_003101334.1.67205 WP_003101334.1.67261 WP_003101334.1.67269 WP_003101334.1.67370 WP_003101334.1.67388 WP_003101334.1.67472 WP_003101334.1.67489 WP_003101334.1.67506 WP_003101334.1.67526 WP_003101334.1.67686 WP_003101334.1.67755 WP_003101334.1.67830 WP_003101334.1.67903 WP_003101334.1.67948 WP_003101334.1.68158 WP_003101334.1.68162 WP_003101334.1.68172 WP_003101334.1.68194 WP_003101334.1.68252 WP_003101334.1.68499 WP_003101334.1.68756 WP_003101334.1.68781 WP_003101334.1.68800 WP_003101334.1.68802 WP_003101334.1.68850 WP_003101334.1.68857 WP_003101334.1.68862 WP_003101334.1.68938 WP_003101334.1.68979 WP_003101334.1.69159 WP_003101334.1.69260 WP_003101334.1.6937 WP_003101334.1.69556 WP_003101334.1.69599 WP_003101334.1.69702 WP_003101334.1.69788 WP_003101334.1.69819 WP_003101334.1.69834 WP_003101334.1.69907 WP_003101334.1.69993 WP_003101334.1.70092 WP_003101334.1.70098 WP_003101334.1.70138 WP_003101334.1.70194 WP_003101334.1.70216 WP_003101334.1.70229 WP_003101334.1.70460 WP_003101334.1.70470 WP_003101334.1.70537 WP_003101334.1.70561 WP_003101334.1.70583 WP_003101334.1.70648 WP_003101334.1.70670 WP_003101334.1.70693 WP_003101334.1.7077 WP_003101334.1.70778 WP_003101334.1.70991 WP_003101334.1.71038 WP_003101334.1.71203 WP_003101334.1.71249 WP_003101334.1.71254 WP_003101334.1.7128 WP_003101334.1.71570 WP_003101334.1.7163 WP_003101334.1.71642 WP_003101334.1.71666 WP_003101334.1.71738 WP_003101334.1.71806 WP_003101334.1.71822 WP_003101334.1.71891 WP_003101334.1.71934 WP_003101334.1.72149 WP_003101334.1.72167 WP_003101334.1.72181 WP_003101334.1.72287 WP_003101334.1.72331 WP_003101334.1.72346 WP_003101334.1.72458 WP_003101334.1.72541 WP_003101334.1.72562 WP_003101334.1.72570 WP_003101334.1.72653 WP_003101334.1.72727 WP_003101334.1.72768 WP_003101334.1.72772 WP_003101334.1.72845 WP_003101334.1.72920 WP_003101334.1.73048 WP_003101334.1.73149 WP_003101334.1.73172 WP_003101334.1.7327 WP_003101334.1.733 WP_003101334.1.73455 WP_003101334.1.73523 WP_003101334.1.73541 WP_003101334.1.73728 WP_003101334.1.7377 WP_003101334.1.7382 WP_003101334.1.73911 WP_003101334.1.73941 WP_003101334.1.74 WP_003101334.1.74000 WP_003101334.1.74072 WP_003101334.1.74074 WP_003101334.1.7408 WP_003101334.1.74175 WP_003101334.1.74219 WP_003101334.1.74264 WP_003101334.1.74268 WP_003101334.1.74281 WP_003101334.1.74287 WP_003101334.1.74326 WP_003101334.1.7445 WP_003101334.1.74458 WP_003101334.1.74473 WP_003101334.1.7448 WP_003101334.1.7456 WP_003101334.1.74568 WP_003101334.1.74629 WP_003101334.1.74685 WP_003101334.1.748 WP_003101334.1.74878 WP_003101334.1.74948 WP_003101334.1.75204 WP_003101334.1.75303 WP_003101334.1.75431 WP_003101334.1.7547 WP_003101334.1.75549 WP_003101334.1.75573 WP_003101334.1.75580 WP_003101334.1.75599 WP_003101334.1.75603 WP_003101334.1.75631 WP_003101334.1.75792 WP_003101334.1.75938 WP_003101334.1.7595 WP_003101334.1.76077 WP_003101334.1.76092 WP_003101334.1.76141 WP_003101334.1.76322 WP_003101334.1.76355 WP_003101334.1.76383 WP_003101334.1.76484 WP_003101334.1.76600 WP_003101334.1.76716 WP_003101334.1.76775 WP_003101334.1.76861 WP_003101334.1.76985 WP_003101334.1.77235 WP_003101334.1.77286 WP_003101334.1.77317 WP_003101334.1.77490 WP_003101334.1.77566 WP_003101334.1.77574 WP_003101334.1.77587 WP_003101334.1.77686 WP_003101334.1.77769 WP_003101334.1.7779 WP_003101334.1.77819 WP_003101334.1.77834 WP_003101334.1.78112 WP_003101334.1.78118 WP_003101334.1.78134 WP_003101334.1.78158 WP_003101334.1.78280 WP_003101334.1.78288 WP_003101334.1.78380 WP_003101334.1.7840 WP_003101334.1.78409 WP_003101334.1.78425 WP_003101334.1.78430 WP_003101334.1.78437 WP_003101334.1.78570 WP_003101334.1.78623 WP_003101334.1.78810 WP_003101334.1.78986 WP_003101334.1.7899 WP_003101334.1.79007 WP_003101334.1.79177 WP_003101334.1.79256 WP_003101334.1.79279 WP_003101334.1.79311 WP_003101334.1.79364 WP_003101334.1.79431 WP_003101334.1.7945 WP_003101334.1.79463 WP_003101334.1.79507 WP_003101334.1.7953 WP_003101334.1.79544 WP_003101334.1.79569 WP_003101334.1.79754 WP_003101334.1.79788 WP_003101334.1.79862 WP_003101334.1.79908 WP_003101334.1.8028 WP_003101334.1.80306 WP_003101334.1.8038 WP_003101334.1.80410 WP_003101334.1.80481 WP_003101334.1.8051 WP_003101334.1.80535 WP_003101334.1.80632 WP_003101334.1.8064 WP_003101334.1.80645 WP_003101334.1.80683 WP_003101334.1.80785 WP_003101334.1.80880 WP_003101334.1.80910 WP_003101334.1.80931 WP_003101334.1.80938 WP_003101334.1.80969 WP_003101334.1.81082 WP_003101334.1.81206 WP_003101334.1.81331 WP_003101334.1.81368 WP_003101334.1.81426 WP_003101334.1.81470 WP_003101334.1.81482 WP_003101334.1.81581 WP_003101334.1.81591 WP_003101334.1.81708 WP_003101334.1.81728 WP_003101334.1.81742 WP_003101334.1.81771 WP_003101334.1.81802 WP_003101334.1.81844 WP_003101334.1.81856 WP_003101334.1.81874 WP_003101334.1.81927 WP_003101334.1.81950 WP_003101334.1.81957 WP_003101334.1.81960 WP_003101334.1.82127 WP_003101334.1.82334 WP_003101334.1.8238 WP_003101334.1.82606 WP_003101334.1.82620 WP_003101334.1.82643 WP_003101334.1.82686 WP_003101334.1.82710 WP_003101334.1.82936 WP_003101334.1.83025 WP_003101334.1.83184 WP_003101334.1.83251 WP_003101334.1.83267 WP_003101334.1.83296 WP_003101334.1.83374 WP_003101334.1.83394 WP_003101334.1.83440 WP_003101334.1.83460 WP_003101334.1.835 WP_003101334.1.83503 WP_003101334.1.8353 WP_003101334.1.83540 WP_003101334.1.83637 WP_003101334.1.83698 WP_003101334.1.83946 WP_003101334.1.84008 WP_003101334.1.84174 WP_003101334.1.84177 WP_003101334.1.84178 WP_003101334.1.84190 WP_003101334.1.84203 WP_003101334.1.84297 WP_003101334.1.8437 WP_003101334.1.84374 WP_003101334.1.84398 WP_003101334.1.84404 WP_003101334.1.84439 WP_003101334.1.84471 WP_003101334.1.8453 WP_003101334.1.84538 WP_003101334.1.84558 WP_003101334.1.84674 WP_003101334.1.84684 WP_003101334.1.84715 WP_003101334.1.84754 WP_003101334.1.84792 WP_003101334.1.84865 WP_003101334.1.84937 WP_003101334.1.85018 WP_003101334.1.85150 WP_003101334.1.85220 WP_003101334.1.85290 WP_003101334.1.85303 WP_003101334.1.85318 WP_003101334.1.85638 WP_003101334.1.85788 WP_003101334.1.85897 WP_003101334.1.85910 WP_003101334.1.85920 WP_003101334.1.86002 WP_003101334.1.86047 WP_003101334.1.861 WP_003101334.1.86125 WP_003101334.1.86182 WP_003101334.1.86278 WP_003101334.1.86287 WP_003101334.1.86293 WP_003101334.1.86386 WP_003101334.1.86432 WP_003101334.1.865 WP_003101334.1.86545 WP_003101334.1.86552 WP_003101334.1.86554 WP_003101334.1.86665 WP_003101334.1.86708 WP_003101334.1.86733 WP_003101334.1.86785 WP_003101334.1.86796 WP_003101334.1.86822 WP_003101334.1.86947 WP_003101334.1.86970 WP_003101334.1.86985 WP_003101334.1.87104 WP_003101334.1.87163 WP_003101334.1.8718 WP_003101334.1.87182 WP_003101334.1.8727 WP_003101334.1.87435 WP_003101334.1.87530 WP_003101334.1.87547 WP_003101334.1.87648 WP_003101334.1.87763 WP_003101334.1.8785 WP_003101334.1.87888 WP_003101334.1.87970 WP_003101334.1.87987 WP_003101334.1.88308 WP_003101334.1.88330 WP_003101334.1.88388 WP_003101334.1.88415 WP_003101334.1.88517 WP_003101334.1.88540 WP_003101334.1.88550 WP_003101334.1.88578 WP_003101334.1.88659 WP_003101334.1.88679 WP_003101334.1.88680 WP_003101334.1.88714 WP_003101334.1.889 WP_003101334.1.88949 WP_003101334.1.8911 WP_003101334.1.89234 WP_003101334.1.89266 WP_003101334.1.89276 WP_003101334.1.89409 WP_003101334.1.89434 WP_003101334.1.89480 WP_003101334.1.8949 WP_003101334.1.89491 WP_003101334.1.89523 WP_003101334.1.89577 WP_003101334.1.89638 WP_003101334.1.89662 WP_003101334.1.89736 WP_003101334.1.8976 WP_003101334.1.89776 WP_003101334.1.89805 WP_003101334.1.89866 WP_003101334.1.89867 WP_003101334.1.89868 WP_003101334.1.89871 WP_003101334.1.89992 WP_003101334.1.90024 WP_003101334.1.90032 WP_003101334.1.90056 WP_003101334.1.90141 WP_003101334.1.90150 WP_003101334.1.90189 WP_003101334.1.90225 WP_003101334.1.90242 WP_003101334.1.90306 WP_003101334.1.90412 WP_003101334.1.9056 WP_003101334.1.90569 WP_003101334.1.90770 WP_003101334.1.90940 WP_003101334.1.91161 WP_003101334.1.9120 WP_003101334.1.91204 WP_003101334.1.91392 WP_003101334.1.9143 WP_003101334.1.91431 WP_003101334.1.91438 WP_003101334.1.91467 WP_003101334.1.91527 WP_003101334.1.91563 WP_003101334.1.91585 WP_003101334.1.91803 WP_003101334.1.9182 WP_003101334.1.91846 WP_003101334.1.91860 WP_003101334.1.91862 WP_003101334.1.92175 WP_003101334.1.92314 WP_003101334.1.92321 WP_003101334.1.92357 WP_003101334.1.92454 WP_003101334.1.92573 WP_003101334.1.92585 WP_003101334.1.92587 WP_003101334.1.92624 WP_003101334.1.92630 WP_003101334.1.9272 WP_003101334.1.92759 WP_003101334.1.92769 WP_003101334.1.92847 WP_003101334.1.92894 WP_003101334.1.92924 WP_003101334.1.92930 WP_003101334.1.93001 WP_003101334.1.93090 WP_003101334.1.93122 WP_003101334.1.93148 WP_003101334.1.93250 WP_003101334.1.93264 WP_003101334.1.9328 WP_003101334.1.93493 WP_003101334.1.93498 WP_003101334.1.93568 WP_003101334.1.93889 WP_003101334.1.93897 WP_003101334.1.94004 WP_003101334.1.94065 WP_003101334.1.94078 WP_003101334.1.94174 WP_003101334.1.94218 WP_003101334.1.94230 WP_003101334.1.94243 WP_003101334.1.94285 WP_003101334.1.94333 WP_003101334.1.94434 WP_003101334.1.9444 WP_003101334.1.94450 WP_003101334.1.94682 WP_003101334.1.94818 WP_003101334.1.94874 WP_003101334.1.94896 WP_003101334.1.94897 WP_003101334.1.95025 WP_003101334.1.95027 WP_003101334.1.95056 WP_003101334.1.95117 WP_003101334.1.95132 WP_003101334.1.95187 WP_003101334.1.95207 WP_003101334.1.95324 WP_003101334.1.95354 WP_003101334.1.95460 WP_003101334.1.95525 WP_003101334.1.95536 WP_003101334.1.95668 WP_003101334.1.95774 WP_003101334.1.95782 WP_003101334.1.95787 WP_003101334.1.95820 WP_003101334.1.95825 WP_003101334.1.9599 WP_003101334.1.95994 WP_003101334.1.96041 WP_003101334.1.96058 WP_003101334.1.961 WP_003101334.1.96134 WP_003101334.1.96243 WP_003101334.1.96267 WP_003101334.1.96434 WP_003101334.1.96667 WP_003101334.1.96702 WP_003101334.1.96880 WP_003101334.1.96967 WP_003101334.1.9706 WP_003101334.1.97118 WP_003101334.1.97204 WP_003101334.1.97213 WP_003101334.1.9722 WP_003101334.1.97272 WP_003101334.1.97474 WP_003101334.1.97521 WP_003101334.1.97614 WP_003101334.1.97826 WP_003101334.1.97877 WP_003101334.1.97968 WP_003101334.1.98111 WP_003101334.1.98260 WP_003101334.1.98276 WP_003101334.1.98308 WP_003101334.1.98410 WP_003101334.1.98414 WP_003101334.1.98433 WP_003101334.1.985 WP_003101334.1.98573 WP_003101334.1.98600 WP_003101334.1.98610 WP_003101334.1.98788 WP_003101334.1.98814 WP_003101334.1.9885 WP_003101334.1.98873 WP_003101334.1.98926 WP_003101334.1.98958 WP_003101334.1.98960 WP_003101334.1.98963 WP_003101334.1.99065 WP_003101334.1.99103 WP_003101334.1.99214 WP_003101334.1.99293 WP_003101334.1.99353 WP_003101334.1.99378 WP_003101334.1.99386 WP_003101334.1.99461 WP_003101334.1.9951 WP_003101334.1.99647 WP_003101334.1.99654 WP_003101334.1.99662 WP_003101334.1.99746 WP_003101334.1.99757 WP_003101334.1.99772 WP_003101334.1.99795 WP_003101334.1.9989 gi|386056833|ref|YP_005973355.1| gi|478476966|ref|YP_007707617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]